Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G24764 71 / 7e-16 ATMAP70-2 microtubule-associated proteins 70-2 (.1) AT2G01750 64 / 3e-13 ATMAP70-3 microtubule-associated proteins 70-3 (.1.2) AT1G68060 64 / 4e-13 ATMAP70-1 microtubule-associated proteins 70-1 (.1) AT1G14840 62 / 2e-12 ATMAP70-4 microtubule-associated proteins 70-4 (.1.2) AT4G17220 56 / 3e-10 ATMAP70-5 microtubule-associated proteins 70-5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038790 [exp] 160 / 3e-48 AT4G17220 473 / 5e-163 microtubule-associated proteins 70-5 (.1) Lus10013238 [exp] 72 / 8e-16 AT1G24764 910 / 0.0 microtubule-associated proteins 70-2 (.1) Lus10030758 [exp] 71 / 9e-16 AT1G24764 918 / 0.0 microtubule-associated proteins 70-2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G018000 [exp] 102 / 9e-27 AT4G17220 464 / 5e-159 microtubule-associated proteins 70-5 (.1) Potri.016G006900 [exp] 98 / 4e-25 AT4G17220 453 / 1e-154 microtubule-associated proteins 70-5 (.1) Potri.016G036300 [exp] 74 / 9e-17 AT1G68060 619 / 0.0 microtubule-associated proteins 70-1 (.1) Potri.006G039200 [exp] 72 / 3e-16 AT1G24764 648 / 0.0 microtubule-associated proteins 70-2 (.1) Potri.008G135100 [exp] 72 / 5e-16 AT1G24764 804 / 0.0 microtubule-associated proteins 70-2 (.1) Potri.010G106100 [exp] 71 / 9e-16 AT1G68060 751 / 0.0 microtubule-associated proteins 70-1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039069 pacid=23150321 polypeptide=Lus10039069 locus=Lus10039069.g ID=Lus10039069.BGIv1.0 annot-version=v1.0 ATGGTGGGTTTTGATGAACAAGTTGCTGCAGTTAGAGGTGGAGTTGAAGAAGAGCTCATCCTCTCTCACCCTGACCCTGTTATTCTGGAGCTCAACCGCT TGCAGAATCTCCTCAAAGATAAGGATAGAGAATTGGGAGCTACTCATGGAGAAATCAAAGGTTTGAGAACAAATGATGCACTCAAGGACAAGGCAATAGA AGAATTGAGGATTCGGATGAACAAACTTGATGAGAAGTTGCATGCTTCCGAGACTATGATCGAGAACAAGGTTGGTTTGTCCATGATTCTTGCTCGAGTT TAA
AA sequence Show only first row Show all	>Lus10039069 pacid=23150321 polypeptide=Lus10039069 locus=Lus10039069.g ID=Lus10039069.BGIv1.0 annot-version=v1.0 MVGFDEQVAAVRGGVEEELILSHPDPVILELNRLQNLLKDKDRELGATHGEIKGLRTNDALKDKAIEELRIRMNKLDEKLHASETMIENKVGLSMILARV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G24764		ATMAP70-2	microtubule-associated protein...		Lus10039069 [exp]	0	1
AT2G04160		AIR3	AUXIN-INDUCED IN ROOT CULTURES...		Lus10032424 [exp]	2.0	0.9653
					Lus10027053 [exp]	2.6	0.9505
AT5G17890		CHS3, DAR4	CHILLING SENSITIVE 3, DA1-rela...		Lus10025852 [exp]	2.8	0.9461
AT3G22640		PAP85	cupin family protein (.1)		Lus10022072 [exp]	3.5	0.9625
AT5G22460			alpha/beta-Hydrolases superfam...		Lus10020604 [exp]	3.7	0.9364
AT3G20860		ATNEK5	NIMA-related kinase 5 (.1)		Lus10031834 [exp]	4.0	0.9632
AT5G12950			Putative glycosyl hydrolase of...		Lus10031829 [exp]	5.8	0.9317
AT3G20860		ATNEK5	NIMA-related kinase 5 (.1)		Lus10031265 [exp]	8.1	0.9524
AT4G17220		ATMAP70-5	microtubule-associated protein...		Lus10038790 [exp]	9.2	0.9520
AT2G44220			Protein of Unknown Function (D...		Lus10036998 [exp]	9.6	0.9041

Compare expression of checked genes

Lus10039069 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.