Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038789 [exp] 201 / 3e-68 ND / Lus10001828 [exp] 40 / 4e-05 ND 35 / 0.003
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G018200 [exp] 97 / 1e-26 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039070 pacid=23150472 polypeptide=Lus10039070 locus=Lus10039070.g ID=Lus10039070.BGIv1.0 annot-version=v1.0 ATGGGTAATTGTATAAATGTCATGAGCTGTTCGAGACCCGAGAAGAGCATGATGCTCGTCTCCAATGAAGAAGACGAAGAATTCAGTACCCAAAAAACAC GGGTTAGAAAGACCGGCTACAATGGTCGTCAAGGCTCCAAAGTGGCTGACCACTCGGTCCTGTCGTATGAACGTTTTCTGGCAGGTGCAAAGCTGGAGCA AGGGAAAGTTAAGATTGTTTTGACAAGGGAACAGCTCGATTTCATCCTCAACAATGCGAAGGAACTGAGATCTAAAGGGATTGTGGTCAGAGTTCCTCAG AGCTACAAGGAATCCAATTGCAGGAAATGGCAGCCGTCTTTAACCACCATCCGTGAGGTGAAATCTTTTTGA
AA sequence Show only first row Show all	>Lus10039070 pacid=23150472 polypeptide=Lus10039070 locus=Lus10039070.g ID=Lus10039070.BGIv1.0 annot-version=v1.0 MGNCINVMSCSRPEKSMMLVSNEEDEEFSTQKTRVRKTGYNGRQGSKVADHSVLSYERFLAGAKLEQGKVKIVLTREQLDFILNNAKELRSKGIVVRVPQ SYKESNCRKWQPSLTTIREVKSF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10039070 [exp]	0	1
AT5G18570		EMB3138, ATOBGL...	EMBRYO DEFECTIVE 3138, EMBRYO ...		Lus10006128 [exp]	2.0	0.8814
AT4G21760		BGLU47	beta-glucosidase 47 (.1)		Lus10032659 [exp]	3.5	0.8566
AT1G72640			NAD(P)-binding Rossmann-fold s...		Lus10000373 [exp]	5.1	0.8698
AT2G46090			Diacylglycerol kinase family p...		Lus10036388 [exp]	5.3	0.8611
AT5G02180			Transmembrane amino acid trans...		Lus10024374 [exp]	6.0	0.8675
AT3G02600		ATLPP3, LPP3	lipid phosphate phosphatase 3 ...		Lus10028489 [exp]	6.5	0.8506
AT1G55300		TAF7	TBP-associated factor 7 (.1.2)		Lus10017011 [exp]	7.5	0.8502
AT1G62680			Pentatricopeptide repeat (PPR)...		Lus10042220 [exp]	11.8	0.8188
AT1G35340			ATP-dependent protease La (LON...		Lus10008251 [exp]	12.0	0.8402
AT5G08490		SLG1	SLOW GROWTH 1, Tetratricopepti...		Lus10014828 [exp]	12.8	0.8245

Compare expression of checked genes

Lus10039070 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.