Lus10039073 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G16380 76 / 5e-17 Heavy metal transport/detoxification superfamily protein (.1.2)
AT1G49420 58 / 8e-11 Heavy metal transport/detoxification superfamily protein (.1)
AT1G51090 53 / 5e-09 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038786 123 / 1e-35 AT1G49420 108 / 1e-28 Heavy metal transport/detoxification superfamily protein (.1)
Lus10001913 82 / 5e-19 AT4G16380 90 / 1e-21 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10000039 76 / 2e-17 AT4G16380 81 / 6e-19 Heavy metal transport/detoxification superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G019200 89 / 2e-22 AT4G16380 86 / 3e-20 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G019300 87 / 6e-21 AT4G16380 94 / 1e-22 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G019100 86 / 2e-20 AT4G16380 59 / 8e-10 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G018400 82 / 9e-20 AT4G16380 81 / 9e-19 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G018901 81 / 1e-19 AT4G16380 81 / 1e-18 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.016G006700 80 / 7e-19 AT4G16380 45 / 2e-05 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G019500 77 / 3e-18 AT4G16380 78 / 7e-18 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G019800 74 / 2e-16 AT4G16380 82 / 6e-19 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G019400 73 / 2e-16 AT4G16380 79 / 4e-18 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.006G020500 71 / 2e-15 AT4G16380 73 / 9e-16 Heavy metal transport/detoxification superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00403 HMA Heavy-metal-associated domain
Representative CDS sequence
>Lus10039073 pacid=23150440 polypeptide=Lus10039073 locus=Lus10039073.g ID=Lus10039073.BGIv1.0 annot-version=v1.0
ATGGGAGGAGAATCAAAGCTCACAACTATGGTGATCAAGGTGGATCTGGACTGCCACAAGTGCCGCAAGAAGATCAAGAAAGTCCTCTGCAAAATCCCCC
AGATTCAGAACCAAGTGTACGACGAGAAGGCCAATTTGGTGACGATAACAGTGTGGTGCTGCAGCCCTGAGAAGGTGAAAGACAAGATTTGCTGCAAAGG
AGGAGAGTCGGTGAAGGGAATAGAGATCGTCAAACCACCGCCGGCGAAGCCGAAGGAGCCGGAAAAGCCCAAGGAGAAGCCCAAAGAGCCGGAGAAGGCT
AAGGAGAAGCCCAAGGAGCCGGAAAAGCCGAAGGAAAAGCCCAAAGAGAAGCCGAAGGAACCAGAGGGGAAACCCAAGGAGAAGCCGCAAGAGATGGCAC
CGAAGAAGCCGGCTGCTGCGCTAAGCAGCTTCCGGGGCGCCGGTGAACGCGACCTGGGGCGGCGGCGGCGGATATTACTGCCCGCCGGGAGCGTACAGGA
AGCAGCCTGGGCAGTGCTTTAG
AA sequence
>Lus10039073 pacid=23150440 polypeptide=Lus10039073 locus=Lus10039073.g ID=Lus10039073.BGIv1.0 annot-version=v1.0
MGGESKLTTMVIKVDLDCHKCRKKIKKVLCKIPQIQNQVYDEKANLVTITVWCCSPEKVKDKICCKGGESVKGIEIVKPPPAKPKEPEKPKEKPKEPEKA
KEKPKEPEKPKEKPKEKPKEPEGKPKEKPQEMAPKKPAAALSSFRGAGERDLGRRRRILLPAGSVQEAAWAVL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G16380 Heavy metal transport/detoxifi... Lus10039073 0 1
AT4G04960 Concanavalin A-like lectin pro... Lus10015313 1.7 0.8688
AT2G47650 UXS4 UDP-xylose synthase 4 (.1.2) Lus10003605 3.0 0.8470
AT2G46620 P-loop containing nucleoside t... Lus10030220 5.8 0.8783
AT2G43630 unknown protein Lus10002105 9.1 0.8788
AT4G18700 ATWL4, CIPK12, ... SNF1-RELATED PROTEIN KINASE 3.... Lus10007284 10.2 0.8545
AT3G05320 O-fucosyltransferase family pr... Lus10018291 13.9 0.8514
AT2G43630 unknown protein Lus10013892 14.0 0.8526
AT1G11770 FAD-binding Berberine family p... Lus10038440 15.1 0.8213
AT3G11660 NHL1 NDR1/HIN1-like 1 (.1) Lus10016960 17.3 0.8290
AT1G23040 hydroxyproline-rich glycoprote... Lus10043475 23.9 0.8447

Lus10039073 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.