Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G47630 119 / 2e-35 MTACP3 mitochondrial acyl carrier protein 3 (.1.2) AT2G44620 88 / 1e-23 MTACP1, MTACP-1 mitochondrial acyl carrier protein 1 (.1) AT1G65290 75 / 3e-18 MTACP2 mitochondrial acyl carrier protein 2 (.1) AT3G05020 46 / 5e-07 ACP1 acyl carrier protein 1 (.1) AT1G54630 43 / 6e-06 ACP3 acyl carrier protein 3 (.1.2) AT5G27200 42 / 2e-05 ACP5 acyl carrier protein 5 (.1) AT1G54580 41 / 3e-05 ACP2 acyl carrier protein 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000050 [exp] 254 / 2e-89 AT5G47630 119 / 1e-35 mitochondrial acyl carrier protein 3 (.1.2) Lus10038782 [exp] 240 / 9e-84 AT5G47630 112 / 6e-33 mitochondrial acyl carrier protein 3 (.1.2) Lus10020221 [exp] 86 / 1e-22 AT1G65290 183 / 4e-61 mitochondrial acyl carrier protein 2 (.1) Lus10026849 [exp] 85 / 3e-20 AT1G08450 590 / 0.0 PRIORITY IN SWEET LIFE 1, EMS-MUTAGENIZED BRI1 SUPPRESSOR 2, A. thaliana calreticulin 3, calreticulin 3 (.1.2.3) Lus10043348 [exp] 76 / 1e-18 AT2G44620 186 / 1e-62 mitochondrial acyl carrier protein 1 (.1) Lus10019500 [exp] 76 / 1e-18 AT2G44620 186 / 1e-62 mitochondrial acyl carrier protein 1 (.1) Lus10038636 [exp] 42 / 2e-05 AT4G25050 134 / 3e-41 acyl carrier protein 4 (.1.2) Lus10038635 [exp] 42 / 2e-05 AT4G25050 134 / 3e-41 acyl carrier protein 4 (.1.2) Lus10037910 [exp] 42 / 2e-05 AT4G25050 130 / 4e-40 acyl carrier protein 4 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G005700 [exp] 162 / 1e-52 AT5G47630 107 / 5e-31 mitochondrial acyl carrier protein 3 (.1.2) Potri.016G006300 [exp] 147 / 1e-46 AT5G47630 111 / 1e-32 mitochondrial acyl carrier protein 3 (.1.2) Potri.019G055300 [exp] 80 / 2e-20 AT1G65290 196 / 6e-66 mitochondrial acyl carrier protein 2 (.1) Potri.013G084500 [exp] 79 / 1e-19 AT1G65290 188 / 5e-63 mitochondrial acyl carrier protein 2 (.1) Potri.014G044000 [exp] 77 / 3e-19 AT2G44620 163 / 2e-53 mitochondrial acyl carrier protein 1 (.1) Potri.002G135600 [exp] 67 / 4e-15 AT2G44620 177 / 1e-58 mitochondrial acyl carrier protein 1 (.1) Potri.015G104500 [exp] 42 / 1e-05 AT4G25050 122 / 2e-36 acyl carrier protein 4 (.1.2) Potri.006G217800 [exp] 41 / 4e-05 AT1G54630 94 / 2e-25 acyl carrier protein 3 (.1.2) Potri.012G105300 [exp] 40 / 0.0001 AT4G25050 107 / 8e-31 acyl carrier protein 4 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0314 [flax] [poplar] PP-binding PF00550 [flax] [poplar] PP-binding Phosphopantetheine attachment site
Representative CDS sequence Show only first row Show all	>Lus10039077 pacid=23150385 polypeptide=Lus10039077 locus=Lus10039077.g ID=Lus10039077.BGIv1.0 annot-version=v1.0 ATGCAGAGTGTCAGAAACAAAATTTTAAGCCATGTCAGGGTGAGGGTAATTCCTCAAGAGTGGTCGCTTCATCAGAGGGCTGGTCTGTTCAAGAAATTGC AAATGGGATTTTGTGCTGCAACGGATGCAATTCCTGAGCACATTATGAATCGGGTGATTGGATTGGTTAAGAAATTTGACAAAATAGAAGCCAACAAGGT TACCGAAACAGCTTATTTCCAGCAAGATTTATGCCTGGACAGTCTAGACAGGGTGGAACTTGTCATGGCTTTCGAAGAGGAGTTCGATATCGTGATCCCT GATGAAGAAGCAGATAAACTCTTGTGCTGTGCTGATGTTGCAAGATTTATATCTTCTGCAAACAGATCGTAA
AA sequence Show only first row Show all	>Lus10039077 pacid=23150385 polypeptide=Lus10039077 locus=Lus10039077.g ID=Lus10039077.BGIv1.0 annot-version=v1.0 MQSVRNKILSHVRVRVIPQEWSLHQRAGLFKKLQMGFCAATDAIPEHIMNRVIGLVKKFDKIEANKVTETAYFQQDLCLDSLDRVELVMAFEEEFDIVIP DEEADKLLCCADVARFISSANRS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G47630		MTACP3	mitochondrial acyl carrier pro...		Lus10039077 [exp]	0	1
AT5G47630		MTACP3	mitochondrial acyl carrier pro...		Lus10000050 [exp]	1.4	0.8399
AT4G11410			NAD(P)-binding Rossmann-fold s...		Lus10032281 [exp]	2.0	0.7426
AT3G27230			S-adenosyl-L-methionine-depend...		Lus10012420 [exp]	8.5	0.7022
AT5G39680		EMB2744	EMBRYO DEFECTIVE 2744, Pentatr...		Lus10042368 [exp]	11.3	0.5805
AT1G02100		SBI1	SUPPRESSOR OF BRI1, Leucine ca...		Lus10042909 [exp]	12.4	0.5691
AT1G07210			Ribosomal protein S18 (.1)		Lus10039100 [exp]	12.7	0.6673
AT1G08640		CJD1	Chloroplast J-like domain 1 (....		Lus10042564 [exp]	17.2	0.7287
AT1G67785			unknown protein		Lus10018082 [exp]	19.6	0.6463
AT1G76065			LYR family of Fe/S cluster bio...		Lus10005622 [exp]	19.8	0.6713
AT1G74680			Exostosin family protein (.1)		Lus10024214 [exp]	25.5	0.6573

Compare expression of checked genes

Lus10039077 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.