Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59810 91 / 3e-22 ATSBT5.4 Subtilase family protein (.1) AT2G04160 84 / 5e-20 AIR3 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1) AT5G11940 66 / 2e-13 Subtilase family protein (.1) AT1G66220 65 / 2e-13 Subtilase family protein (.1) AT5G45650 65 / 2e-13 subtilase family protein (.1) AT4G21640 65 / 3e-13 Subtilase family protein (.1) AT5G67360 64 / 6e-13 ARA12 Subtilase family protein (.1) AT4G10530 63 / 1e-12 Subtilase family protein (.1) AT4G10520 63 / 2e-12 Subtilase family protein (.1) AT1G20160 62 / 4e-12 ATSBT5.2 Subtilisin-like serine endopeptidase family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038772 [exp] 196 / 7e-60 AT5G59810 815 / 0.0 Subtilase family protein (.1) Lus10039085 [exp] 164 / 2e-48 AT5G59810 827 / 0.0 Subtilase family protein (.1) Lus10039087 [exp] 162 / 2e-47 AT2G04160 810 / 0.0 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1) Lus10039086 [exp] 160 / 5e-47 AT5G59810 850 / 0.0 Subtilase family protein (.1) Lus10038774 [exp] 157 / 1e-45 AT5G59810 839 / 0.0 Subtilase family protein (.1) Lus10007083 [exp] 90 / 5e-22 AT5G45650 956 / 0.0 subtilase family protein (.1) Lus10020458 [exp] 86 / 2e-20 AT5G45650 940 / 0.0 subtilase family protein (.1) Lus10032425 [exp] 86 / 2e-20 AT5G59810 607 / 0.0 Subtilase family protein (.1) Lus10006505 [exp] 84 / 6e-20 AT2G04160 745 / 0.0 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G050300 [exp] 105 / 1e-27 AT2G04160 786 / 0.0 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1) Potri.011G050100 [exp] 103 / 1e-26 AT2G04160 784 / 0.0 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1) Potri.011G050000 [exp] 101 / 4e-26 AT2G04160 806 / 0.0 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1) Potri.006G001600 [exp] 99 / 5e-25 AT5G59810 970 / 0.0 Subtilase family protein (.1) Potri.014G171600 [exp] 96 / 4e-24 AT2G04160 986 / 0.0 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1) Potri.011G165900 [exp] 96 / 5e-24 AT2G04160 882 / 0.0 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1) Potri.007G102250 [exp] 94 / 1e-23 AT2G04160 821 / 0.0 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1) Potri.005G067200 [exp] 94 / 2e-23 AT2G04160 786 / 0.0 AUXIN-INDUCED IN ROOT CULTURES 3, Subtilisin-like serine endopeptidase family protein (.1) Potri.001G468800 [exp] 93 / 5e-23 AT5G59810 939 / 0.0 Subtilase family protein (.1) Potri.001G468900 [exp] 92 / 6e-23 AT5G59810 730 / 0.0 Subtilase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039089 pacid=23150329 polypeptide=Lus10039089 locus=Lus10039089.g ID=Lus10039089.BGIv1.0 annot-version=v1.0 ATGCTTTTCGCGGAGTCTCCTTACAAGTGTCCCGAACCTGCTGTGAGCATCCTCGACCTCAACTACCCTTCGATCGCGGTCCCTAAGCTTCCCTTGACAG GTTCGATTACCGTGACTAGGAAGCTGACGAATGTAGGGAAGCCAGGCAAGTACACTGTCTCGGTTAAGGAATGGACAGGGGTTTCGATTTCGGTGAAGGC TAGTGTCCTGACGTTTGAGAAGGAGGGGGGAGAGAAGGAGTTCAAGGTGATTCTGAAGGCCAAGTGGGGTGGTAAGGGCCAGGGGAATGATTATGTGTTT GGAGGAATTACATGGACAGATGGTGTCCATTATGTAAGAAGTCCTGTTGCTGTTTCTCCTGCTTAG
AA sequence Show only first row Show all	>Lus10039089 pacid=23150329 polypeptide=Lus10039089 locus=Lus10039089.g ID=Lus10039089.BGIv1.0 annot-version=v1.0 MLFAESPYKCPEPAVSILDLNYPSIAVPKLPLTGSITVTRKLTNVGKPGKYTVSVKEWTGVSISVKASVLTFEKEGGEKEFKVILKAKWGGKGQGNDYVF GGITWTDGVHYVRSPVAVSPA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59810		ATSBT5.4	Subtilase family protein (.1)		Lus10039089 [exp]	0	1

Compare expression of checked genes

Lus10039089 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.