Lus10039092 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G48350 216 / 6e-73 EMB3105 EMBRYO DEFECTIVE 3105, Ribosomal L18p/L5e family protein (.1)
AT1G14205 76 / 6e-18 Ribosomal L18p/L5e family protein (.1)
AT3G17626 61 / 5e-13 structural constituent of ribosome (.1)
AT5G27820 44 / 4e-06 Ribosomal L18p/L5e family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038770 329 / 1e-117 AT1G48350 216 / 6e-73 EMBRYO DEFECTIVE 3105, Ribosomal L18p/L5e family protein (.1)
Lus10030465 76 / 1e-17 AT1G14205 174 / 2e-56 Ribosomal L18p/L5e family protein (.1)
Lus10012820 73 / 2e-16 AT1G14205 182 / 2e-59 Ribosomal L18p/L5e family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G005000 236 / 9e-81 AT1G48350 229 / 4e-78 EMBRYO DEFECTIVE 3105, Ribosomal L18p/L5e family protein (.1)
Potri.008G087100 73 / 8e-17 AT1G14205 202 / 2e-67 Ribosomal L18p/L5e family protein (.1)
Potri.007G100900 39 / 0.0005 AT5G27820 155 / 3e-50 Ribosomal L18p/L5e family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0267 S11_L18p PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Representative CDS sequence
>Lus10039092 pacid=23150490 polypeptide=Lus10039092 locus=Lus10039092.g ID=Lus10039092.BGIv1.0 annot-version=v1.0
ATGGCTACTTGTTCCTTCTCCACCAACTTTGTGGGCTTCAGCCACAATCACCTATCGGCAGCTGTCGCCGGGAAGCCACGCTTGAGCTCAATTGCTCTCC
CCACCCGACTCACGGTTGAAGCCAAATCCAGAACCAGAGGAGACGACAGGACCGCTCGCCATATTCGAATCAGAAAGAAGGTTGAAGGCACTACAGAGCG
GCCGAGGTTGTCTGTCTTCCGTTCAAACAAGCATTTCTACGTCCAGGTGATCGATGACTCCAAGATGCACACTCTCGCTGCTGCTTCCACAATGCAGAAG
GTGATGGCGGAGGAGCTCAACTTCACCGCAGGTCCTACCATTGAAGTAGCAAAAAAGGTGGGTGAAGCTATAGCGAAGGCATGCTTGGAGAAAGGGATAA
CGAAAGTGGCCTTTGACAGAGGTGGCTATCCATACCACGGTCGAGTAAAAGCTCTTGCTGATGCAGCTCGTGAGAACGGGCTTCAGTTCTAA
AA sequence
>Lus10039092 pacid=23150490 polypeptide=Lus10039092 locus=Lus10039092.g ID=Lus10039092.BGIv1.0 annot-version=v1.0
MATCSFSTNFVGFSHNHLSAAVAGKPRLSSIALPTRLTVEAKSRTRGDDRTARHIRIRKKVEGTTERPRLSVFRSNKHFYVQVIDDSKMHTLAAASTMQK
VMAEELNFTAGPTIEVAKKVGEAIAKACLEKGITKVAFDRGGYPYHGRVKALADAARENGLQF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G48350 EMB3105 EMBRYO DEFECTIVE 3105, Ribosom... Lus10039092 0 1
AT1G48350 EMB3105 EMBRYO DEFECTIVE 3105, Ribosom... Lus10038770 1.4 0.9824
AT1G29070 Ribosomal protein L34 (.1) Lus10013928 2.0 0.9796
AT2G43030 Ribosomal protein L3 family pr... Lus10001337 2.8 0.9748
AT3G14110 FLU FLUORESCENT IN BLUE LIGHT, Tet... Lus10013168 3.0 0.9686
AT2G43030 Ribosomal protein L3 family pr... Lus10013640 3.2 0.9709
AT3G13120 Ribosomal protein S10p/S20e fa... Lus10016604 3.9 0.9765
AT1G07320 EMB2784, RPL4 EMBRYO DEFECTIVE 2784, ribosom... Lus10040693 4.0 0.9687
AT4G38160 PDE191 pigment defective 191, Mitocho... Lus10026571 5.3 0.9662
ATCG00900 ATCG00900.1, RP... CHLOROPLAST RIBOSOMAL PROTEIN ... Lus10027894 5.9 0.9690
AT5G65220 Ribosomal L29 family protein ... Lus10019653 6.2 0.9662

Lus10039092 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.