Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G05030 73 / 3e-18 Copper transport protein family (.1) AT3G20180 54 / 4e-11 Copper transport protein family (.1) AT3G07600 49 / 9e-09 Heavy metal transport/detoxification superfamily protein (.1) AT5G48290 49 / 2e-08 Heavy metal transport/detoxification superfamily protein (.1.2) AT3G05920 38 / 9e-05 Heavy metal transport/detoxification superfamily protein (.1) AT5G26690 37 / 0.0001 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038769 [exp] 148 / 3e-48 AT4G05030 76 / 3e-19 Copper transport protein family (.1) Lus10016059 [exp] 54 / 8e-11 AT4G05030 62 / 2e-13 Copper transport protein family (.1) Lus10025179 [exp] 53 / 3e-10 AT4G05030 62 / 1e-13 Copper transport protein family (.1) Lus10025180 [exp] 52 / 3e-10 AT5G48290 81 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10016063 [exp] 52 / 4e-10 AT3G07600 64 / 8e-14 Heavy metal transport/detoxification superfamily protein (.1) Lus10016061 [exp] 52 / 5e-10 AT5G48290 82 / 1e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10025182 [exp] 50 / 2e-09 AT5G48290 62 / 5e-13 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10014967 [exp] 42 / 1e-05 AT1G01490 100 / 9e-27 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10007911 [exp] 41 / 2e-05 AT1G01490 128 / 2e-37 Heavy metal transport/detoxification superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G001800 [exp] 83 / 8e-23 AT4G05030 73 / 2e-18 Copper transport protein family (.1) Potri.006G001900 [exp] 82 / 1e-22 AT4G05030 88 / 3e-24 Copper transport protein family (.1) Potri.001G468500 [exp] 66 / 1e-15 AT4G05030 65 / 1e-14 Copper transport protein family (.1) Potri.016G002600 [exp] 64 / 2e-15 AT4G05030 72 / 2e-18 Copper transport protein family (.1) Potri.014G171300 [exp] 60 / 4e-13 AT3G07600 75 / 5e-18 Heavy metal transport/detoxification superfamily protein (.1) Potri.009G048100 [exp] 56 / 1e-11 AT3G07600 79 / 8e-20 Heavy metal transport/detoxification superfamily protein (.1) Potri.006G002000 [exp] 55 / 1e-11 AT4G05030 54 / 3e-11 Copper transport protein family (.1) Potri.009G048400 [exp] 55 / 2e-11 AT3G07600 80 / 3e-20 Heavy metal transport/detoxification superfamily protein (.1) Potri.014G171500 [exp] 54 / 5e-11 AT3G07600 73 / 3e-17 Heavy metal transport/detoxification superfamily protein (.1) Potri.009G048300 [exp] 52 / 3e-10 AT3G07600 80 / 4e-20 Heavy metal transport/detoxification superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [flax] [poplar] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Lus10039093 pacid=23150496 polypeptide=Lus10039093 locus=Lus10039093.g ID=Lus10039093.BGIv1.0 annot-version=v1.0 ATGACTAACAAGATCGTGTACAAGCTGCAGCTCAGTTGCCAGAAATGTCAAACAAAGGCACTCCAGGTTGCTGCAGAGGCAAAGGGTGTCAACTACGTGG GTTTCGAAGGAGATTCGAAGGAGAATTTGGTGGTGGTGGGGGATGATGTGGATCCGGTGAAGCTGGCTATCAAGTTGAGGAAGAAAGTTAAGGTGGCAGA AATCCTCAGTGTTACTGTTGTGGATTCAGCTTGA
AA sequence Show only first row Show all	>Lus10039093 pacid=23150496 polypeptide=Lus10039093 locus=Lus10039093.g ID=Lus10039093.BGIv1.0 annot-version=v1.0 MTNKIVYKLQLSCQKCQTKALQVAAEAKGVNYVGFEGDSKENLVVVGDDVDPVKLAIKLRKKVKVAEILSVTVVDSA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G05030			Copper transport protein famil...		Lus10039093 [exp]	0	1
AT2G45550		CYP76C4	"cytochrome P450, family 76, s...		Lus10028896 [exp]	1.0	0.8881
AT2G04040		ATDTX1	detoxification 1, MATE efflux ...		Lus10009132 [exp]	1.4	0.8853
AT4G10120		ATSPS4F	Sucrose-phosphate synthase fam...		Lus10006184 [exp]	1.7	0.8029
AT1G68630			PLAC8 family protein (.1)		Lus10008890 [exp]	3.9	0.7901
AT3G14820			GDSL-like Lipase/Acylhydrolase...		Lus10028424 [exp]	6.5	0.7876
AT3G07600			Heavy metal transport/detoxifi...		Lus10016060 [exp]	11.8	0.7926
AT2G27035		AtENODL20	early nodulin-like protein 20 ...		Lus10026749 [exp]	13.7	0.7785
AT3G48950			Pectin lyase-like superfamily ...		Lus10027516 [exp]	15.0	0.7463
AT4G37940	MADS	AGL21	AGAMOUS-like 21 (.1)		Lus10020477 [exp]	17.7	0.7709
					Lus10017842 [exp]	19.7	0.7678

Compare expression of checked genes

Lus10039093 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.