Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G47550 70 / 2e-16 Cystatin/monellin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027320 [exp] 105 / 3e-30 AT5G47550 59 / 4e-12 Cystatin/monellin superfamily protein (.1) Lus10010495 [exp] 62 / 2e-13 AT5G47550 73 / 1e-17 Cystatin/monellin superfamily protein (.1) Lus10017567 [exp] 57 / 3e-11 AT5G47550 69 / 7e-16 Cystatin/monellin superfamily protein (.1) Lus10034773 [exp] 45 / 7e-07 AT5G47550 65 / 1e-14 Cystatin/monellin superfamily protein (.1) Lus10025748 [exp] 43 / 3e-06 ND 37 / 5e-04 Lus10039023 [exp] 43 / 1e-05 AT5G47560 332 / 2e-112 tonoplast dicarboxylate transporter (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G014500 [exp] 75 / 1e-18 AT5G47550 100 / 9e-29 Cystatin/monellin superfamily protein (.1) Potri.006G014700 [exp] 66 / 3e-15 AT5G47550 62 / 3e-13 Cystatin/monellin superfamily protein (.1) Potri.006G014600 [exp] 47 / 2e-07 AT5G47550 56 / 6e-11 Cystatin/monellin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0121 [flax] [poplar] Cystatin PF00031 [flax] [poplar] Cystatin Cystatin domain
Representative CDS sequence Show only first row Show all	>Lus10039104 pacid=23150317 polypeptide=Lus10039104 locus=Lus10039104.g ID=Lus10039104.BGIv1.0 annot-version=v1.0 ATGGCAGTGAAGCCAATCATGTCTCTAGTGGTGATGGCAACCGTTGTCGTCGCCATATCGGCCGTTGGAGCGATTGTCGGAGAATGGCAGCCGATAACGA ACCTGAAGGACAAACATGTCACCGAGATTGCTGAGTTCGCTGTGAACGCTTACGATGGCCAAGCCCCGAAGAAGGAACTGAAGTTTGTTAGCGTGGAGAA AGGCGAGTACCAAGTGGTGGCAGGGATGAACTACAAGCTTACAATAACCGCAACCGATGGCCAACATCAAATAGGTTCACAACAATATCAAGCGATTGTG TACGAGAATCTGAAGCAGTTAAAGACATTAGTCTCGTTTCTTCCGAGGGAATGA
AA sequence Show only first row Show all	>Lus10039104 pacid=23150317 polypeptide=Lus10039104 locus=Lus10039104.g ID=Lus10039104.BGIv1.0 annot-version=v1.0 MAVKPIMSLVVMATVVVAISAVGAIVGEWQPITNLKDKHVTEIAEFAVNAYDGQAPKKELKFVSVEKGEYQVVAGMNYKLTITATDGQHQIGSQQYQAIV YENLKQLKTLVSFLPRE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G47550			Cystatin/monellin superfamily ...		Lus10039104 [exp]	0	1
AT1G17860			Kunitz family trypsin and prot...		Lus10007889 [exp]	4.9	0.9285
AT3G09220		LAC7	laccase 7 (.1)		Lus10035546 [exp]	5.4	0.9485
AT5G06740			Concanavalin A-like lectin pro...		Lus10021060 [exp]	6.3	0.9357
AT5G65380			MATE efflux family protein (.1...		Lus10012741 [exp]	10.4	0.9469
AT5G39160			RmlC-like cupins superfamily p...		Lus10035185 [exp]	15.2	0.9306
AT3G06490	MYB	BOS1, AtMYB108	BOTRYTIS-SUSCEPTIBLE1, myb dom...		Lus10037818 [exp]	18.7	0.9406
AT2G14095			unknown protein		Lus10001300 [exp]	19.8	0.9461
AT3G54220	GRAS	SGR1, SCR	SHOOT GRAVITROPISM 1, SCARECRO...		Lus10014822 [exp]	20.0	0.9163
AT5G12340			unknown protein		Lus10036031 [exp]	20.8	0.9373
AT2G37770		ChlAKR, AKR4C9	Chloroplastic aldo-keto reduct...		Lus10024354 [exp]	22.0	0.9218

Compare expression of checked genes

Lus10039104 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.