Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G47710 240 / 2e-82 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2) AT1G66360 137 / 1e-41 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) AT1G48590 132 / 2e-39 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2), Calcium-dependent lipid-binding (CaLB domain) family protein (.3) AT3G17980 130 / 1e-38 AtC2 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) AT5G37740 129 / 1e-38 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2) AT1G70790 129 / 4e-38 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2) AT4G05330 132 / 1e-37 AGD13 ARF-GAP domain 13 (.1) AT1G73580 125 / 8e-37 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) AT4G21160 129 / 2e-36 ZAC, AGD12 ARF-GAP domain 12, Calcium-dependent ARF-type GTPase activating protein family (.1.2.3.4) AT3G07940 127 / 1e-35 Calcium-dependent ARF-type GTPase activating protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038745 [exp] 334 / 2e-119 AT5G47710 241 / 1e-82 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2) Lus10033585 [exp] 135 / 7e-41 AT3G17980 244 / 1e-83 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Lus10017629 [exp] 134 / 3e-40 AT3G17980 241 / 2e-82 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Lus10038539 [exp] 137 / 5e-40 AT4G21160 491 / 4e-176 ARF-GAP domain 12, Calcium-dependent ARF-type GTPase activating protein family (.1.2.3.4) Lus10042002 [exp] 132 / 2e-39 AT1G48590 240 / 6e-82 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2), Calcium-dependent lipid-binding (CaLB domain) family protein (.3) Lus10024165 [exp] 136 / 8e-38 AT3G07940 491 / 1e-171 Calcium-dependent ARF-type GTPase activating protein family (.1) Lus10016347 [exp] 136 / 1e-37 AT3G07940 478 / 8e-164 Calcium-dependent ARF-type GTPase activating protein family (.1) Lus10039538 [exp] 135 / 1e-37 AT3G07940 490 / 4e-171 Calcium-dependent ARF-type GTPase activating protein family (.1) Lus10009684 [exp] 128 / 4e-37 AT3G17980 254 / 1e-86 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G004600 [exp] 263 / 2e-91 AT5G47710 270 / 3e-94 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2) Potri.016G005300 [exp] 257 / 3e-89 AT5G47710 264 / 1e-91 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2) Potri.017G125500 [exp] 134 / 3e-40 AT3G17980 249 / 6e-86 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Potri.004G089500 [exp] 133 / 3e-40 AT3G17980 245 / 4e-84 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Potri.012G047100 [exp] 132 / 1e-39 AT3G17980 251 / 2e-86 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Potri.001G372000 [exp] 133 / 3e-38 AT4G21160 506 / 0.0 ARF-GAP domain 12, Calcium-dependent ARF-type GTPase activating protein family (.1.2.3.4) Potri.008G131500 [exp] 128 / 3e-38 AT3G17980 202 / 5e-67 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Potri.010G110900 [exp] 126 / 3e-37 AT1G70790 233 / 3e-79 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2) Potri.T125706 [exp] 132 / 5e-37 AT3G07940 503 / 8e-178 Calcium-dependent ARF-type GTPase activating protein family (.1) Potri.003G198301 [exp] 132 / 5e-37 AT3G07940 503 / 7e-178 Calcium-dependent ARF-type GTPase activating protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0154 [flax] [poplar] C2 PF00168 [flax] [poplar] C2 C2 domain
Representative CDS sequence Show only first row Show all	>Lus10039113 pacid=23150658 polypeptide=Lus10039113 locus=Lus10039113.g ID=Lus10039113.BGIv1.0 annot-version=v1.0 ATGGGAGAACAGCACGGGTTGCTGAAAGTGACTGTGGTTCAGGGGAAGAGACTGGCTATCCGCGACTTCAAAACCAGCGATCCGTACGTAATTGTCAAGC TAGGCAATCAAATAGCAAGGACAAAGGTCATAAACAGTTGCCTTAATCCAGTCTGGAATGAAGAGCTACTTTTCTCCCTTACAGAACCCCTAGCTGGAGT ATTAAACTTGGAAGTGTATGACAAAGACCGGTTCAAGGCAGACGACAAGATGGGAAGGGCCGAGCTGAACCTTCAGCCAATCGCCTCAGCTGCACGGCTT AAGCAGATCCTACACGTTTCCTCATCGGGTCAAACAGTGTTGAGGAAAGTCGTCCCGGACAGCGATAACTGTCTCATAAGGGAAAGCACCATTGCTTGTA TAGAAGGTGAAGTGGTGCAAAGTGTGTGGTTGAAGCTCCATGAAGTCGAGTCTGGGGAGATAGAACTGAAGATCAAGCTGATCAATTCATCAGCAGCACA GTGA
AA sequence Show only first row Show all	>Lus10039113 pacid=23150658 polypeptide=Lus10039113 locus=Lus10039113.g ID=Lus10039113.BGIv1.0 annot-version=v1.0 MGEQHGLLKVTVVQGKRLAIRDFKTSDPYVIVKLGNQIARTKVINSCLNPVWNEELLFSLTEPLAGVLNLEVYDKDRFKADDKMGRAELNLQPIASAARL KQILHVSSSGQTVLRKVVPDSDNCLIRESTIACIEGEVVQSVWLKLHEVESGEIELKIKLINSSAAQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G47710			Calcium-dependent lipid-bindin...		Lus10039113 [exp]	0	1
AT3G05290		AtPNC1, PNC1	peroxisomal adenine nucleotide...		Lus10010517 [exp]	12.8	0.7528
AT4G27800		TAP38, PPH1	PROTEIN PHOSPHATASE 1, thylako...		Lus10005908 [exp]	16.6	0.7487
AT4G10925			Nuclear transport factor 2 (NT...		Lus10001815 [exp]	17.0	0.7081
AT5G42700	B3		AP2/B3-like transcriptional fa...		Lus10032748 [exp]	17.3	0.7249
AT4G10810			unknown protein		Lus10012620 [exp]	21.4	0.6740
AT3G12480	CCAAT	NF-YC11	"nuclear factor Y, subunit C11...		Lus10041638 [exp]	22.3	0.7394
AT1G06110		SKIP16	SKP1/ASK-interacting protein 1...		Lus10027693 [exp]	23.2	0.7437
AT4G25180			RNA polymerase III RPC4 (.1)		Lus10009655 [exp]	27.1	0.7371
AT2G03390			uvrB/uvrC motif-containing pro...		Lus10037120 [exp]	35.2	0.7220
AT4G25970		PSD3, PSD2	phosphatidylserine decarboxyla...		Lus10015839 [exp]	38.4	0.6863

Compare expression of checked genes

Lus10039113 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.