Lus10039120 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G64620 57 / 2e-10 ATC/VIF2, C/VIF2 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
AT3G17152 48 / 3e-07 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G17150 44 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038738 248 / 2e-85 AT5G64620 67 / 4e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Lus10038737 99 / 3e-26 AT5G64620 56 / 7e-10 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Lus10027947 53 / 8e-09 AT1G47960 111 / 1e-30 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10000822 48 / 4e-07 AT1G47960 113 / 1e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10022409 44 / 2e-05 AT5G64620 155 / 3e-48 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Lus10017345 40 / 0.0002 AT3G17220 89 / 1e-22 pectin methylesterase inhibitor 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G013400 126 / 5e-37 AT5G64620 66 / 8e-14 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.016G001600 108 / 3e-30 AT5G64620 82 / 9e-20 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.008G102600 51 / 3e-08 AT3G17130 153 / 1e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.002G191500 50 / 7e-08 AT2G31430 104 / 2e-28 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.002G066300 45 / 4e-06 ND /
Potri.004G016500 44 / 2e-05 AT4G02250 73 / 2e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.007G108301 42 / 4e-05 AT5G64620 163 / 1e-51 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.006G134900 42 / 4e-05 AT5G64620 76 / 2e-17 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.009G083500 40 / 0.0002 AT1G47960 114 / 7e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.010G209800 39 / 0.0006 AT5G64620 93 / 5e-24 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10039120 pacid=23150612 polypeptide=Lus10039120 locus=Lus10039120.g ID=Lus10039120.BGIv1.0 annot-version=v1.0
ATGTCCACCTCCCTCCTCGTCCCGCTACTACTACTCCTTCTCATCTCAACAGCCGCCATCTCCATCGCCGCCGCACCGACGAACCTCGTCCAGCAACTCT
GCAAGAAAACCTTTGCTTACGCGCTGTGCGTGGAGGCGCTGTACGCGGACTCCAGGACGCCGGACGCCGACCGGACCACCATGGCGTTCATCTCCGTCGG
GCTGGCCTACCAGAACGCCACCGGTACCCGCACCTACATCTCCGGCCTTCACGGCGGCGGTCGGGTCGGGCGGGAGCGGCTCAGCAGATGCGGATCCGAC
TACGACGTCGCGATCACTAAGATGGAGCGGGCCTCCAACGATTTGAATTCCGAGACGTACTACGGCCTGGCTGAGCTGGCAAAGGGAGCCGCCGACGCTG
CCAAACACTGCCAGGCTGTATTCGCGAAGTCCACGTGGCAGCCCATGGGGAACCGGAACCGGGTGTTGGCGGTTTTGTGTGAGGTTATTGGGGTGATTGG
GAAGTCCTTCACCGGCAAAGATTGA
AA sequence
>Lus10039120 pacid=23150612 polypeptide=Lus10039120 locus=Lus10039120.g ID=Lus10039120.BGIv1.0 annot-version=v1.0
MSTSLLVPLLLLLLISTAAISIAAAPTNLVQQLCKKTFAYALCVEALYADSRTPDADRTTMAFISVGLAYQNATGTRTYISGLHGGGRVGRERLSRCGSD
YDVAITKMERASNDLNSETYYGLAELAKGAADAAKHCQAVFAKSTWQPMGNRNRVLAVLCEVIGVIGKSFTGKD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G64620 ATC/VIF2, C/VIF... cell wall / vacuolar inhibitor... Lus10039120 0 1
AT5G47040 LON2 lon protease 2 (.1) Lus10001083 3.9 0.8970
AT4G28240 Wound-responsive family protei... Lus10031617 7.2 0.8582
AT1G02610 RING/FYVE/PHD zinc finger supe... Lus10010011 13.0 0.8470
AT1G79720 Eukaryotic aspartyl protease f... Lus10024098 17.3 0.8382
AT1G01820 PEX11C peroxin 11c (.1) Lus10041368 18.8 0.8388
AT3G27820 ATMDAR4 monodehydroascorbate reductase... Lus10022260 21.2 0.8011
AT5G10600 CYP81K2 "cytochrome P450, family 81, s... Lus10009909 24.9 0.8512
AT3G02750 Protein phosphatase 2C family ... Lus10021486 25.7 0.8443
AT4G36040 J11 DnaJ11, Chaperone DnaJ-domain ... Lus10041906 28.0 0.8376
AT4G24220 5[beta]-StR, 5[... VEIN PATTERNING 1, Δ4,5-s... Lus10000076 28.5 0.8560

Lus10039120 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.