Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G03070 144 / 5e-46 NADH-ubiquinone oxidoreductase-related (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013785 [exp] 141 / 3e-42 AT3G18110 296 / 3e-91 embryo defective 1270, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10004363 [exp] 93 / 8e-26 AT3G03070 87 / 9e-24 NADH-ubiquinone oxidoreductase-related (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G082100 [exp] 150 / 9e-49 AT3G03070 153 / 1e-49 NADH-ubiquinone oxidoreductase-related (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0045 [flax] [poplar] Rubredoxin PF10276 [flax] [poplar] zf-CHCC Zinc-finger domain
Representative CDS sequence Show only first row Show all	>Lus10039147 pacid=23150247 polypeptide=Lus10039147 locus=Lus10039147.g ID=Lus10039147.BGIv1.0 annot-version=v1.0 ATGGCGTCCATTTTGTTCAAATCCCTAGCGAGGCCGTCAGCGGCTTTGCTGGCTTCCTCTTCCTCCACCGCAACAAGAAGTCTGAGCCTTATCAGCAGTC AAATCAGCCCACACACAGCCAAATGGATGCAGGACACTACTAAGAAATCTCCAATGGAGTTGATCAACGAAATTCCTCCCATCAAGGTTGAAGGAAGGAT TGCCGCTTGTGAAGGGGATACCAACCCTGCACTTGGACATCCAATTGAGTTCATCTGCCTGGACTTGAAGGAGCCAGCAGTATGCAAGTATTGTGGTCTG CAGTATGTCCAGGATCATCATCATTAG
AA sequence Show only first row Show all	>Lus10039147 pacid=23150247 polypeptide=Lus10039147 locus=Lus10039147.g ID=Lus10039147.BGIv1.0 annot-version=v1.0 MASILFKSLARPSAALLASSSSTATRSLSLISSQISPHTAKWMQDTTKKSPMELINEIPPIKVEGRIAACEGDTNPALGHPIEFICLDLKEPAVCKYCGL QYVQDHHH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G03070			NADH-ubiquinone oxidoreductase...		Lus10039147 [exp]	0	1
AT2G44360			unknown protein		Lus10012711 [exp]	1.0	0.8907
AT2G33220			GRIM-19 protein (.1)		Lus10035237 [exp]	3.7	0.8283
AT1G55340			Protein of unknown function (D...		Lus10010650 [exp]	4.0	0.8729
AT2G19790			SNARE-like superfamily protein...		Lus10035004 [exp]	4.9	0.8659
AT1G26550			FKBP-like peptidyl-prolyl cis-...		Lus10019084 [exp]	6.5	0.8605
AT1G04290			Thioesterase superfamily prote...		Lus10004288 [exp]	7.2	0.8642
AT4G21105			cytochrome-c oxidases;electron...		Lus10020569 [exp]	9.1	0.7617
AT3G52730			ubiquinol-cytochrome C reducta...		Lus10022716 [exp]	10.4	0.7822
AT1G07960		ATPDIL5-1	PDI-like 5-1 (.1.2.3)		Lus10036125 [exp]	11.4	0.8403
AT2G29960		CYP19-4, ATCYP5...	CYCLOPHILIN 19-4, ARABIDOPSIS ...		Lus10018238 [exp]	12.0	0.8453

Compare expression of checked genes

Lus10039147 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.