Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G14040 111 / 5e-30 Pectin lyase-like superfamily protein (.1) AT3G07850 108 / 1e-28 Pectin lyase-like superfamily protein (.1) AT3G07840 97 / 1e-24 Pectin lyase-like superfamily protein (.1) AT5G48140 95 / 4e-24 Pectin lyase-like superfamily protein (.1) AT3G07820 94 / 1e-23 Pectin lyase-like superfamily protein (.1) AT3G07830 94 / 2e-23 Pectin lyase-like superfamily protein (.1) AT4G18180 91 / 1e-22 Pectin lyase-like superfamily protein (.1) AT2G43890 86 / 1e-20 Pectin lyase-like superfamily protein (.1) AT2G43870 83 / 9e-20 Pectin lyase-like superfamily protein (.1) AT1G05650 81 / 4e-19 Pectin lyase-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039154 [exp] 223 / 3e-73 AT5G48140 335 / 8e-113 Pectin lyase-like superfamily protein (.1) Lus10013784 [exp] 222 / 1e-72 AT5G48140 337 / 2e-113 Pectin lyase-like superfamily protein (.1) Lus10013780 [exp] 222 / 1e-72 AT5G48140 337 / 2e-113 Pectin lyase-like superfamily protein (.1) Lus10006167 [exp] 124 / 2e-35 AT3G07830 224 / 3e-70 Pectin lyase-like superfamily protein (.1) Lus10043088 [exp] 124 / 3e-35 AT3G07820 360 / 6e-123 Pectin lyase-like superfamily protein (.1) Lus10009605 [exp] 122 / 2e-33 AT3G07840 317 / 1e-102 Pectin lyase-like superfamily protein (.1) Lus10009606 [exp] 120 / 2e-33 AT3G07840 323 / 4e-108 Pectin lyase-like superfamily protein (.1) Lus10041059 [exp] 116 / 1e-31 AT3G07830 310 / 1e-102 Pectin lyase-like superfamily protein (.1) Lus10041058 [exp] 116 / 1e-31 AT3G07830 311 / 1e-102 Pectin lyase-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G067100 [exp] 139 / 1e-40 AT3G07820 404 / 5e-140 Pectin lyase-like superfamily protein (.1) Potri.019G067166 [exp] 138 / 2e-40 AT3G07820 400 / 3e-138 Pectin lyase-like superfamily protein (.1) Potri.019G067200 [exp] 138 / 2e-40 AT3G07820 400 / 3e-138 Pectin lyase-like superfamily protein (.1) Potri.019G067133 [exp] 138 / 2e-40 AT3G07820 400 / 3e-138 Pectin lyase-like superfamily protein (.1) Potri.019G066800 [exp] 125 / 2e-35 AT3G07820 399 / 5e-138 Pectin lyase-like superfamily protein (.1) Potri.019G067000 [exp] 125 / 2e-35 AT3G07820 399 / 5e-138 Pectin lyase-like superfamily protein (.1) Potri.019G067050 [exp] 125 / 2e-35 AT3G07820 399 / 5e-138 Pectin lyase-like superfamily protein (.1) Potri.007G035800 [exp] 122 / 4e-34 AT3G07820 350 / 7e-119 Pectin lyase-like superfamily protein (.1) Potri.014G162300 [exp] 94 / 6e-24 AT3G07850 358 / 3e-122 Pectin lyase-like superfamily protein (.1) Potri.009G038100 [exp] 93 / 3e-23 AT1G78400 357 / 4e-121 Pectin lyase-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0268 [flax] [poplar] Pec_lyase-like PF00295 [flax] [poplar] Glyco_hydro_28 Glycosyl hydrolases family 28
Representative CDS sequence Show only first row Show all	>Lus10039150 pacid=23150430 polypeptide=Lus10039150 locus=Lus10039150.g ID=Lus10039150.BGIv1.0 annot-version=v1.0 ATGGTGAAAGGAATCCACTTCAAGAACTGTACGTTGACCAACACATGCAATGGTGTAAGAATCAAATCATGTCCAGATCTAAAGGCAGGTTCGACAACTG ATATCAGCTTTGAAGACATCATAATGAATAACGTCTCTTTCCCAATCGTCATCGATCAAGTTTATTGCCCGTGGAACACGTGGAAGAAAACAGGGGTGCC GTCGAAAGTGAAAATATCGGGCGTGACATACAACAACATACGAGGAACATCAGCAACGCCGCAGATAGTGCAGATGAATTGCAGTTCAGCAAATCCTTGT GAAGATATTAAACTCTCTGCTTGCGCCAGTGTCAAACCCATTGTTACCGGCACTATCCCGCCTGGTTGCGTCTAA
AA sequence Show only first row Show all	>Lus10039150 pacid=23150430 polypeptide=Lus10039150 locus=Lus10039150.g ID=Lus10039150.BGIv1.0 annot-version=v1.0 MVKGIHFKNCTLTNTCNGVRIKSCPDLKAGSTTDISFEDIIMNNVSFPIVIDQVYCPWNTWKKTGVPSKVKISGVTYNNIRGTSATPQIVQMNCSSANPC EDIKLSACASVKPIVTGTIPPGCV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G14040			Pectin lyase-like superfamily ...		Lus10039150 [exp]	0	1
AT1G47550		SEC3A	exocyst complex component sec3...		Lus10001022 [exp]	3.5	1.0000
AT5G67440		MEL2, NPY3	NAKED PINS IN YUC MUTANTS 3, M...		Lus10025193 [exp]	4.9	1.0000
AT4G14130		XTR7, XTH15	xyloglucan endotransglycosylas...		Lus10008888 [exp]	6.0	1.0000
					Lus10009177 [exp]	6.9	1.0000
					Lus10035026 [exp]	7.7	1.0000
AT1G54130		AT-RSH3, RSH3, ...	RELA/SPOT homolog 3 (.1)		Lus10011252 [exp]	8.1	1.0000
					Lus10026785 [exp]	8.8	1.0000
					Lus10028048 [exp]	9.4	1.0000
AT5G49330	MYB	PFG3, ATMYB111	PRODUCTION OF FLAVONOL GLYCOSI...		Lus10000008 [exp]	9.9	1.0000
					Lus10001123 [exp]	10.5	1.0000

Compare expression of checked genes

Lus10039150 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.