Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G33865 102 / 4e-31 Ribosomal protein S14p/S29e family protein (.1) AT3G44010 102 / 4e-31 Ribosomal protein S14p/S29e family protein (.1) AT3G43980 102 / 4e-31 Ribosomal protein S14p/S29e family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013779 [exp] 117 / 3e-37 AT3G44010 102 / 5e-31 Ribosomal protein S14p/S29e family protein (.1) Lus10004252 [exp] 128 / 2e-36 AT1G69960 538 / 0.0 serine/threonine protein phosphatase 2A (.1) Lus10013781 [exp] 120 / 5e-35 AT1G33470 182 / 1e-55 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G090000 [exp] 110 / 3e-34 AT4G33865 104 / 1e-31 Ribosomal protein S14p/S29e family protein (.1) Potri.001G295902 [exp] 108 / 9e-34 AT4G33865 108 / 1e-33 Ribosomal protein S14p/S29e family protein (.1) Potri.002G119600 [exp] 108 / 2e-33 AT4G33865 108 / 2e-33 Ribosomal protein S14p/S29e family protein (.1) Potri.014G017701 [exp] 108 / 2e-33 AT4G33865 108 / 2e-33 Ribosomal protein S14p/S29e family protein (.1) Potri.004G043600 [exp] 103 / 1e-31 AT4G33865 103 / 1e-31 Ribosomal protein S14p/S29e family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00253 [flax] [poplar] Ribosomal_S14 Ribosomal protein S14p/S29e
Representative CDS sequence Show only first row Show all	>Lus10039155 pacid=23150393 polypeptide=Lus10039155 locus=Lus10039155.g ID=Lus10039155.BGIv1.0 annot-version=v1.0 ATGGGACATCAGAACGTCTGGAACTCTCACCCGAAGACTTATGGTCCAGGCTCCAGGGCCTGCCGTGTGTGTGGAAACCCTCATGCGATCATCAGGAAGT ACGGGCTGATGTGTTGCAGGCAGTGCTTCCGTAGCAATGCTAAGGAGATTGGTTTCATCAAGGTATAA
AA sequence Show only first row Show all	>Lus10039155 pacid=23150393 polypeptide=Lus10039155 locus=Lus10039155.g ID=Lus10039155.BGIv1.0 annot-version=v1.0 MGHQNVWNSHPKTYGPGSRACRVCGNPHAIIRKYGLMCCRQCFRSNAKEIGFIKV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G44010			Ribosomal protein S14p/S29e fa...		Lus10039155 [exp]	0	1
AT3G53740			Ribosomal protein L36e family ...		Lus10016501 [exp]	4.4	0.8543
AT3G52040			unknown protein		Lus10039586 [exp]	11.0	0.8192
AT5G08560			transducin family protein / WD...		Lus10001412 [exp]	14.1	0.8045
AT3G54070			Ankyrin repeat family protein ...		Lus10038357 [exp]	14.4	0.8255
AT2G19730			Ribosomal L28e protein family ...		Lus10006869 [exp]	15.6	0.8039
AT3G54200			Late embryogenesis abundant (L...		Lus10009831 [exp]	16.1	0.8132
AT2G36620		RPL24A	ribosomal protein L24 (.1)		Lus10024560 [exp]	21.0	0.8059
AT3G48560		TZP5, IMR1, ALS...	TRIAZOLOPYRIMIDINE RESISTANT 5...		Lus10032037 [exp]	24.5	0.8141
AT1G14300			ARM repeat superfamily protein...		Lus10037185 [exp]	25.0	0.8006
AT3G54720		MFO1, HPT, COP2...	PRIMORDIA TIMING, Multifolia, ...		Lus10017223 [exp]	32.6	0.7964

Compare expression of checked genes

Lus10039155 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.