Lus10039163 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G17860 164 / 7e-51 Kunitz family trypsin and protease inhibitor protein (.1)
AT1G73260 125 / 2e-35 ATKTI1 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
AT1G73325 107 / 2e-28 Kunitz family trypsin and protease inhibitor protein (.1)
AT1G73330 82 / 7e-19 ATDR4 drought-repressed 4 (.1)
AT1G72290 45 / 8e-06 Kunitz family trypsin and protease inhibitor protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013770 375 / 7e-134 AT1G17860 166 / 6e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10007889 358 / 3e-127 AT1G17860 163 / 1e-50 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10007890 355 / 6e-126 AT1G17860 166 / 7e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10007892 353 / 8e-125 AT1G17860 163 / 1e-50 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10007902 352 / 2e-124 AT1G17860 162 / 3e-50 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10030354 350 / 9e-124 AT1G17860 160 / 1e-49 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10030355 267 / 8e-91 AT1G17860 149 / 5e-45 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039210 250 / 2e-84 AT1G17860 179 / 4e-57 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10042301 249 / 6e-84 AT1G17860 182 / 2e-58 Kunitz family trypsin and protease inhibitor protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G153400 216 / 3e-71 AT1G17860 223 / 1e-74 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153466 215 / 7e-71 AT1G17860 222 / 4e-74 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153600 210 / 5e-69 AT1G17860 217 / 3e-72 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067900 192 / 6e-62 AT1G17860 183 / 2e-58 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067600 185 / 7e-59 AT1G17860 196 / 9e-64 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153200 181 / 2e-57 AT1G17860 191 / 5e-62 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067800 152 / 3e-46 AT1G17860 137 / 8e-41 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.001G309900 90 / 4e-22 AT1G17860 90 / 2e-22 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.019G006900 88 / 2e-21 AT1G73260 79 / 6e-18 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
Potri.007G111800 81 / 1e-18 AT1G73260 79 / 3e-18 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0066 Trefoil PF00197 Kunitz_legume Trypsin and protease inhibitor
Representative CDS sequence
>Lus10039163 pacid=23150482 polypeptide=Lus10039163 locus=Lus10039163.g ID=Lus10039163.BGIv1.0 annot-version=v1.0
ATGAAGTCAGCAGCAGCAGCAAATGGGATGCTACTCATCGTCGTCCTAATCGCCATCGGTGCTCTCTCCACCGCGTCAGCGGCCAGATCGCTGGCCGAAA
CACTAGCCACGTCATCGCTAACGCCACTCCCCGTCCTGGATGTGGACGGGAAAGTGGTCCGGTCAGGGACCACTTACTACATCCTTCCTGCAACTAGCGG
GGAAGGCGGTGGTGTGGCCATGGCTAGTAAGACCAACGACCCGGAGAGCTGCCCGTTGACCGTGGTCCAGGACGGCGACGAGCTCTCCCAGGGCTTGCCT
CTCACTTTCGGCCCGGTCAACACCAAGGTGGGCTACACTGTTCGCACGTTCACCGACCTCAACGTCAAGTTCTCTGCTGATACGGCCTGCGATGAGGGGA
CGGTGTGGAAGGTGGATGATTATGACGATGATGTGGAGCAGTGGTTTGTGGGAACCGGTGGGGTTGAAGGGAATCCCGGTCCGAGGACTGTGAAGAACTG
GTTCAAGATTTGGAAGTATGGCTCGAACTATAAGTTTTCGTACTGCCCTGCGGTTTGCAAGTCGTGCAAGGTTGATTGCAAGGATGTCGGGATTTATGTG
GATGAGAATGGTGGGAGAAGGTTGGCTTTGGTTGACAAGGAAGGGGATCCTTTTGTGGTCAAGTTTGTGAAGGCAGCTTGA
AA sequence
>Lus10039163 pacid=23150482 polypeptide=Lus10039163 locus=Lus10039163.g ID=Lus10039163.BGIv1.0 annot-version=v1.0
MKSAAAANGMLLIVVLIAIGALSTASAARSLAETLATSSLTPLPVLDVDGKVVRSGTTYYILPATSGEGGGVAMASKTNDPESCPLTVVQDGDELSQGLP
LTFGPVNTKVGYTVRTFTDLNVKFSADTACDEGTVWKVDDYDDDVEQWFVGTGGVEGNPGPRTVKNWFKIWKYGSNYKFSYCPAVCKSCKVDCKDVGIYV
DENGGRRLALVDKEGDPFVVKFVKAA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G17860 Kunitz family trypsin and prot... Lus10039163 0 1
AT1G17860 Kunitz family trypsin and prot... Lus10026357 1.4 0.9958
AT5G09360 LAC14 laccase 14 (.1) Lus10006157 2.4 0.9910
AT1G21326 VQ motif-containing protein (.... Lus10012286 2.4 0.9917
AT1G17860 Kunitz family trypsin and prot... Lus10042301 2.6 0.9896
AT4G17030 ATHEXPBETA3.1, ... expansin-like B1 (.1) Lus10030931 3.0 0.9915
Lus10043316 5.3 0.9913
AT1G06620 2-oxoglutarate (2OG) and Fe(II... Lus10001103 6.7 0.9846
AT1G79460 ATKS1, ATKS, GA... GA REQUIRING 2, ARABIDOPSIS TH... Lus10024120 7.1 0.9912
AT1G06135 unknown protein Lus10000703 7.3 0.9877
AT4G02780 ATCPS1, ABC33, ... GA REQUIRING 1, CPP synthase, ... Lus10042593 8.9 0.9843

Lus10039163 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.