Lus10039164 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G13870 100 / 2e-25 WRNEXO, ATWRNEXO, WEX, ATWEX Werner syndrome-like exonuclease (.1.2)
AT3G12430 82 / 5e-19 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G12460 82 / 9e-19 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT2G36110 79 / 8e-18 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G12410 73 / 2e-15 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G12470 68 / 6e-14 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G12440 70 / 8e-14 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT5G48350 60 / 4e-11 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G12420 54 / 8e-09 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT5G06450 53 / 2e-08 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013769 423 / 1e-152 AT4G13870 105 / 4e-27 Werner syndrome-like exonuclease (.1.2)
Lus10029478 139 / 3e-41 AT5G48350 82 / 2e-19 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10039591 133 / 7e-39 AT3G12410 86 / 1e-20 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10029479 122 / 2e-34 AT2G36110 87 / 4e-21 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10043049 110 / 1e-29 AT2G36110 121 / 4e-34 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10022556 89 / 6e-21 AT4G13870 246 / 1e-80 Werner syndrome-like exonuclease (.1.2)
Lus10036491 64 / 4e-12 AT3G11770 64 / 4e-12 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10010357 63 / 1e-11 AT3G11770 66 / 7e-13 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10016641 54 / 1e-09 AT4G13870 108 / 2e-30 Werner syndrome-like exonuclease (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G028700 260 / 1e-88 AT4G13870 104 / 5e-27 Werner syndrome-like exonuclease (.1.2)
Potri.006G031400 258 / 2e-87 AT3G12410 101 / 2e-26 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.011G116000 146 / 7e-44 AT3G12410 91 / 2e-22 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.017G059200 86 / 9e-20 AT4G13870 288 / 4e-97 Werner syndrome-like exonuclease (.1.2)
Potri.019G021900 74 / 9e-16 AT3G11770 77 / 3e-17 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.013G049000 71 / 5e-15 AT5G06450 / Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.016G028400 58 / 4e-10 ND /
Potri.002G185500 58 / 5e-10 AT3G12410 45 / 1e-05 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.016G028501 50 / 2e-07 ND /
Potri.005G020000 47 / 3e-06 AT1G56310 655 / 0.0 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0219 RNase_H PF01612 DNA_pol_A_exo1 3'-5' exonuclease
Representative CDS sequence
>Lus10039164 pacid=23150273 polypeptide=Lus10039164 locus=Lus10039164.g ID=Lus10039164.BGIv1.0 annot-version=v1.0
ATGCCACCGATCAGCATCATAGACCACCGTCTCCCCGACGAGACTCACAATCTCTACGATGTCACTTTCTTCACCGACGAAATCCACACTCTCCTCACCC
AATCCCCGGGACCCCTCCACCAATGGCTCCTCGAAACCACTCGACAGCAGCAGAGCTCCGGCTCCGCAGTCGCCGTCGTAGTCGGCCTGGACGTGGAGTG
GCGCCCGAACTTCAGCCGCAACCACAACAATCCGATCGCAACTCTCCAGCTCTGCGTGGGCGGCAGGTGTGTGATCTTCCAGCTCATCCACTCCCCGTCC
ATTCCGCAGTCCCTCTTCGATTTCCTTCAGAACAAGGACTTTGTCTTCGTCGGAGTCGGAATCGAGAACGACGTGGAGAAGCTGATCGAGGATTACGGGC
TGACTGTGGCGAACTCGGTCGATCTGAGGGGTCTCGCAGCGGAGAAGCTGGGAGACAAGGCGCTGAAGAACTCGGGGCTGAAGCAGCTGGCCAGAGAGGT
GTTGGGGAAAGAGATCGAGAAGCCGAAAAGGGTTTCGATGAGTAGGTGGGACAATCTGTGGCTCACTCCACTCCAGGTCCAATATGCTTGCGTTGATGCC
TTTTTATCTTATAAGATTGGAGACACTCTCAATGCTGGTTCTGCTGTTGCTCCTGCCGGTGGAGCGTATTAG
AA sequence
>Lus10039164 pacid=23150273 polypeptide=Lus10039164 locus=Lus10039164.g ID=Lus10039164.BGIv1.0 annot-version=v1.0
MPPISIIDHRLPDETHNLYDVTFFTDEIHTLLTQSPGPLHQWLLETTRQQQSSGSAVAVVVGLDVEWRPNFSRNHNNPIATLQLCVGGRCVIFQLIHSPS
IPQSLFDFLQNKDFVFVGVGIENDVEKLIEDYGLTVANSVDLRGLAAEKLGDKALKNSGLKQLAREVLGKEIEKPKRVSMSRWDNLWLTPLQVQYACVDA
FLSYKIGDTLNAGSAVAPAGGAY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G13870 WRNEXO, ATWRNEX... Werner syndrome-like exonuclea... Lus10039164 0 1
AT4G00860 AT0ZI1, ATOZI1 Arabidopsis thaliana ozone-ind... Lus10007542 2.0 0.9497
AT1G28120 unknown protein Lus10026630 2.6 0.9521
AT4G30010 unknown protein Lus10001443 3.3 0.9313
AT3G48730 GSA2 glutamate-1-semialdehyde 2,1-a... Lus10030551 3.5 0.9438
AT5G58710 ROC7 rotamase CYP 7 (.1) Lus10040666 3.6 0.9294
AT2G03190 ASK16 SKP1-like 16 (.1) Lus10031747 4.9 0.9353
AT5G05610 Alfin AL1 alfin-like 1 (.1.2) Lus10040207 5.3 0.9358
AT5G41670 6-phosphogluconate dehydrogena... Lus10024725 6.0 0.9435
AT3G61790 Protein with RING/U-box and TR... Lus10004001 7.7 0.9311
AT3G26340 N-terminal nucleophile aminohy... Lus10006426 8.4 0.9324

Lus10039164 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.