Lus10039174 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G21150 73 / 2e-16 Mitochondrial transcription termination factor family protein (.1)
AT5G07900 65 / 1e-13 Mitochondrial transcription termination factor family protein (.1)
AT1G61980 64 / 2e-13 Mitochondrial transcription termination factor family protein (.1)
AT1G62120 63 / 8e-13 Mitochondrial transcription termination factor family protein (.1)
AT1G62085 61 / 3e-12 Mitochondrial transcription termination factor family protein (.1)
AT1G62110 61 / 3e-12 Mitochondrial transcription termination factor family protein (.1)
AT1G61970 61 / 3e-12 Mitochondrial transcription termination factor family protein (.1.2)
AT3G46950 61 / 4e-12 Mitochondrial transcription termination factor family protein (.1)
AT5G64950 57 / 7e-11 Mitochondrial transcription termination factor family protein (.1)
AT1G61990 57 / 8e-11 Mitochondrial transcription termination factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002883 142 / 4e-42 AT5G07900 196 / 9e-59 Mitochondrial transcription termination factor family protein (.1)
Lus10040819 87 / 3e-22 AT5G07900 130 / 2e-35 Mitochondrial transcription termination factor family protein (.1)
Lus10040462 85 / 6e-22 AT5G07900 93 / 1e-22 Mitochondrial transcription termination factor family protein (.1)
Lus10040820 88 / 1e-21 AT5G07900 221 / 2e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10016551 86 / 1e-21 AT5G07900 144 / 3e-40 Mitochondrial transcription termination factor family protein (.1)
Lus10004957 82 / 8e-20 AT5G07900 238 / 4e-75 Mitochondrial transcription termination factor family protein (.1)
Lus10040818 81 / 1e-19 AT5G07900 129 / 2e-34 Mitochondrial transcription termination factor family protein (.1)
Lus10040817 68 / 1e-14 AT5G07900 225 / 6e-70 Mitochondrial transcription termination factor family protein (.1)
Lus10016550 59 / 3e-11 AT5G07900 219 / 9e-68 Mitochondrial transcription termination factor family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G013100 87 / 2e-21 AT5G07900 198 / 1e-59 Mitochondrial transcription termination factor family protein (.1)
Potri.011G005100 86 / 5e-21 AT5G07900 199 / 1e-59 Mitochondrial transcription termination factor family protein (.1)
Potri.014G133200 85 / 1e-20 AT5G07900 436 / 3e-152 Mitochondrial transcription termination factor family protein (.1)
Potri.004G012900 84 / 1e-20 AT5G07900 220 / 6e-68 Mitochondrial transcription termination factor family protein (.1)
Potri.004G013000 84 / 2e-20 AT5G07900 193 / 1e-57 Mitochondrial transcription termination factor family protein (.1)
Potri.004G012400 84 / 3e-20 AT5G07900 212 / 9e-65 Mitochondrial transcription termination factor family protein (.1)
Potri.010G022700 82 / 1e-19 AT5G07900 220 / 5e-68 Mitochondrial transcription termination factor family protein (.1)
Potri.008G216200 77 / 9e-18 AT5G07900 217 / 8e-67 Mitochondrial transcription termination factor family protein (.1)
Potri.015G038500 76 / 2e-17 AT5G07900 218 / 2e-67 Mitochondrial transcription termination factor family protein (.1)
Potri.015G038400 71 / 9e-16 AT5G07900 237 / 1e-74 Mitochondrial transcription termination factor family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02536 mTERF mTERF
Representative CDS sequence
>Lus10039174 pacid=23150497 polypeptide=Lus10039174 locus=Lus10039174.g ID=Lus10039174.BGIv1.0 annot-version=v1.0
ATGAACACACTTTCAATAGAGGATGCACTAGTAACTTCCAAGTACGTTAGCTTCAAATCCCTGGAGAATTCCAACTCGGTGCTGAGTTTCTTCAGGGAGC
ATGATTTCTCGTCATCCCAGATTTCAAAAGCTGTGAAGCTACGGCCGAAAATTCTTCTCTCCCAGCCAAGCAAGACTCTTTTGCCCAAGCTGCAATTCCT
CCGATCTTTGGGATTCTCCACCCCTGACGTTACCCAGATCTTATCAGTCTGCCATAGAATTTTCTACTCGAGTCTCGAGAATCGGCTGATCCCTTGCTGA
AA sequence
>Lus10039174 pacid=23150497 polypeptide=Lus10039174 locus=Lus10039174.g ID=Lus10039174.BGIv1.0 annot-version=v1.0
MNTLSIEDALVTSKYVSFKSLENSNSVLSFFREHDFSSSQISKAVKLRPKILLSQPSKTLLPKLQFLRSLGFSTPDVTQILSVCHRIFYSSLENRLIPC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G21150 Mitochondrial transcription te... Lus10039174 0 1
Lus10021139 1.0 0.9942
AT5G63810 BGAL10 beta-galactosidase 10 (.1) Lus10023974 4.9 0.8752
Lus10010327 5.1 0.8479
Lus10021851 5.8 0.9460
AT2G36540 Haloacid dehalogenase-like hyd... Lus10016365 6.8 0.8783
AT1G02520 MDR8, ABCB11, P... multi-drug resistance 8, ATP-b... Lus10004530 7.1 0.9460
AT1G70830 MLP28 MLP-like protein 28 (.1.2.3.4.... Lus10012466 7.1 0.8642
Lus10008791 8.2 0.9460
AT1G59840 CCB4 cofactor assembly of complex C... Lus10010732 9.0 0.8372
Lus10012440 9.2 0.9460

Lus10039174 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.