Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G09250 103 / 4e-30 KIWI ssDNA-binding transcriptional regulator (.1.2) AT5G09240 69 / 2e-16 ssDNA-binding transcriptional regulator (.1.2.3) AT4G10920 61 / 7e-13 KELP transcriptional coactivator p15 (PC4) family protein (KELP) (.1), transcriptional coactivator p15 (PC4) family protein (KELP) (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013733 [exp] 152 / 2e-49 AT5G09250 139 / 2e-44 ssDNA-binding transcriptional regulator (.1.2) Lus10032410 [exp] 68 / 2e-15 AT4G10920 169 / 2e-54 transcriptional coactivator p15 (PC4) family protein (KELP) (.1), transcriptional coactivator p15 (PC4) family protein (KELP) (.2) Lus10023061 [exp] 56 / 1e-10 AT4G10920 132 / 7e-40 transcriptional coactivator p15 (PC4) family protein (KELP) (.1), transcriptional coactivator p15 (PC4) family protein (KELP) (.2) Lus10030245 [exp] 52 / 2e-09 AT4G10920 136 / 3e-41 transcriptional coactivator p15 (PC4) family protein (KELP) (.1), transcriptional coactivator p15 (PC4) family protein (KELP) (.2) Lus10003998 [exp] 45 / 2e-06 AT4G00980 226 / 9e-68 zinc knuckle (CCHC-type) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G101100 [exp] 90 / 9e-25 AT5G09250 115 / 7e-35 ssDNA-binding transcriptional regulator (.1.2) Potri.002G171900 [exp] 60 / 8e-12 AT4G00980 373 / 7e-125 zinc knuckle (CCHC-type) family protein (.1) Potri.001G089400 [exp] 54 / 3e-10 AT4G10920 152 / 5e-48 transcriptional coactivator p15 (PC4) family protein (KELP) (.1), transcriptional coactivator p15 (PC4) family protein (KELP) (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0609 [flax] [poplar] sPC4_like PF02229 [flax] [poplar] PC4 Transcriptional Coactivator p15 (PC4)
Representative CDS sequence Show only first row Show all	>Lus10039207 pacid=23150305 polypeptide=Lus10039207 locus=Lus10039207.g ID=Lus10039207.BGIv1.0 annot-version=v1.0 ATGTCTGGAAAATACAAGCGGAAGGAGGTGGAAGAGAATGCGTCCGACGAGGACAGCCATGCTCCTGCTCCAAAGAAAGCTTCCAAAGCTGATGCCTCTG AAGATTCTGACGAAATCGTGGTTTGCGATATATCTCACAACAGGAGAGTGAAAGTGAGGAACTGGCAAGGAAAGGTCTGGGTGGACATTCGTGAGTTCTA CACCAAGGATGGGAAGCAGCTCCCTGGGAAGAAAGGTATCTCTAGATGGAAGGCTCTGAAGGATCATGCTGAAGCAATTGACAAGGCACTTGCTGATTCT TGA
AA sequence Show only first row Show all	>Lus10039207 pacid=23150305 polypeptide=Lus10039207 locus=Lus10039207.g ID=Lus10039207.BGIv1.0 annot-version=v1.0 MSGKYKRKEVEENASDEDSHAPAPKKASKADASEDSDEIVVCDISHNRRVKVRNWQGKVWVDIREFYTKDGKQLPGKKGISRWKALKDHAEAIDKALADS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G09250		KIWI	ssDNA-binding transcriptional ...		Lus10039207 [exp]	0	1
AT1G05430			unknown protein		Lus10006108 [exp]	1.0	0.8203
AT1G77280			Protein kinase protein with ad...		Lus10024154 [exp]	2.0	0.7905
AT5G06210			RNA binding (RRM/RBD/RNP motif...		Lus10013306 [exp]	6.9	0.8191
AT5G62950			RNA polymerase II, Rpb4, core ...		Lus10005329 [exp]	6.9	0.7496
AT5G08630			DDT domain-containing protein ...		Lus10029550 [exp]	7.5	0.7981
AT3G24150			unknown protein		Lus10043262 [exp]	8.5	0.7696
AT4G08310			unknown protein		Lus10028028 [exp]	13.6	0.7577
AT3G17590		CHE1, BSH	BUSHY GROWTH, transcription re...		Lus10005562 [exp]	16.5	0.7246
AT2G47640			Small nuclear ribonucleoprotei...		Lus10007876 [exp]	18.2	0.7785
AT2G30260		U2B''	U2 small nuclear ribonucleopro...		Lus10026413 [exp]	20.1	0.7530

Compare expression of checked genes

Lus10039207 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.