Lus10039208 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G17860 172 / 2e-54 Kunitz family trypsin and protease inhibitor protein (.1)
AT1G73260 117 / 1e-32 ATKTI1 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
AT1G73325 108 / 4e-29 Kunitz family trypsin and protease inhibitor protein (.1)
AT1G73330 81 / 1e-18 ATDR4 drought-repressed 4 (.1)
AT1G72290 58 / 3e-10 Kunitz family trypsin and protease inhibitor protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013732 411 / 2e-148 AT1G17860 166 / 4e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10011090 376 / 1e-134 AT1G17860 161 / 4e-50 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039209 367 / 4e-131 AT1G17860 179 / 6e-57 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10013730 357 / 5e-127 AT1G17860 175 / 2e-55 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039210 357 / 6e-127 AT1G17860 179 / 4e-57 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10013731 358 / 5e-126 AT1G17860 172 / 5e-53 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10022302 353 / 1e-123 AT1G17860 176 / 4e-54 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10042301 330 / 2e-116 AT1G17860 182 / 2e-58 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10026357 328 / 2e-115 AT1G17860 181 / 6e-58 Kunitz family trypsin and protease inhibitor protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G153400 196 / 7e-64 AT1G17860 223 / 1e-74 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153466 195 / 2e-63 AT1G17860 222 / 4e-74 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153600 191 / 1e-61 AT1G17860 217 / 3e-72 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067900 186 / 9e-60 AT1G17860 183 / 2e-58 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067600 185 / 2e-59 AT1G17860 196 / 9e-64 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153200 168 / 1e-52 AT1G17860 191 / 5e-62 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067800 146 / 4e-44 AT1G17860 137 / 8e-41 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.019G006900 99 / 1e-25 AT1G73260 79 / 6e-18 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
Potri.004G000400 87 / 3e-21 AT1G73260 91 / 9e-23 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
Potri.001G309900 81 / 6e-19 AT1G17860 90 / 2e-22 Kunitz family trypsin and protease inhibitor protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0066 Trefoil PF00197 Kunitz_legume Trypsin and protease inhibitor
Representative CDS sequence
>Lus10039208 pacid=23150364 polypeptide=Lus10039208 locus=Lus10039208.g ID=Lus10039208.BGIv1.0 annot-version=v1.0
ATGAAGACAACAATGCTACTTGCAATCTCTTCATTCATCGTAGTCCTTGTCTCCTTCACCACACTTTCATCCGCCGCTTCATTCCTGACTCCGGTCGCTG
ACATCGACGGGGCACCCCTCAGATCGGGCCACAAGTACTTCATCCTCCCATCCGTCTCCGGAAACGGGGGAGGCCTCGCTCTAGGAAGAAGAACCGATAC
AAAGAAATGCCCGCTATCCGTCATCCAGGACGACTACGAGCTCAGCAAGGGTATTCCGGTAGTTTTCCTGCCCATCAACGCCAGGCCGGGCTACACAGTT
CGAACGGACACCGATCTCAACATCGAGTTCGCTGCAGAGACCGCATGTGACGAAGCCCCCGTGTGGAAGGTGGAAAGTTATGACCACGATGTCATGCAGT
GGTTCATTGGCACCGGTGGCATCGAAGGAAAGCCAGGTCCGAGGACAGTGGACAACTGGTTTAAGATTGACAACTACGGCGGGAACTACAAGCTCGTGTA
CTGCCCTTCTGTGTGCAAGGCTTGCAAGGTTCAGTGTAAGGATGTCGGGGTTTACGTGGATGAATATGGCAAGAAGAGGCTTGCTCTTACTGACGATGAG
CCTTCCATTGTTAAGTTCATGAAAGCTCCCAAATAG
AA sequence
>Lus10039208 pacid=23150364 polypeptide=Lus10039208 locus=Lus10039208.g ID=Lus10039208.BGIv1.0 annot-version=v1.0
MKTTMLLAISSFIVVLVSFTTLSSAASFLTPVADIDGAPLRSGHKYFILPSVSGNGGGLALGRRTDTKKCPLSVIQDDYELSKGIPVVFLPINARPGYTV
RTDTDLNIEFAAETACDEAPVWKVESYDHDVMQWFIGTGGIEGKPGPRTVDNWFKIDNYGGNYKLVYCPSVCKACKVQCKDVGVYVDEYGKKRLALTDDE
PSIVKFMKAPK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G17860 Kunitz family trypsin and prot... Lus10039208 0 1
AT1G17860 Kunitz family trypsin and prot... Lus10011090 1.4 0.9755
AT1G17860 Kunitz family trypsin and prot... Lus10013732 3.7 0.9677
AT1G73990 SPPA1, SPPA signal peptide peptidase (.1) Lus10013332 8.0 0.9412
AT1G14550 Peroxidase superfamily protein... Lus10009898 8.9 0.9308
Lus10022008 9.6 0.9518
AT3G57270 BG1 "beta-1,3-glucanase 1", beta-1... Lus10019800 11.4 0.9285
AT2G41480 Peroxidase superfamily protein... Lus10020826 18.5 0.9227
AT1G14540 Peroxidase superfamily protein... Lus10000003 22.7 0.9371
AT3G48280 CYP71A25 "cytochrome P450, family 71, s... Lus10043308 24.4 0.9331
AT4G31940 CYP82C4 "cytochrome P450, family 82, s... Lus10003147 26.5 0.9360

Lus10039208 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.