Lus10039215 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G23750 162 / 2e-50 Remorin family protein (.1.2)
AT3G48940 159 / 2e-49 Remorin family protein (.1)
AT3G61260 156 / 6e-48 Remorin family protein (.1)
AT2G45820 135 / 5e-40 Remorin family protein (.1)
AT1G63295 80 / 4e-19 Remorin family protein (.1)
AT2G41870 56 / 3e-09 Remorin family protein (.1)
AT1G30320 54 / 1e-08 Remorin family protein (.1)
AT3G57540 54 / 1e-08 Remorin family protein (.1)
AT1G67590 54 / 2e-08 Remorin family protein (.1.2)
AT1G53860 47 / 3e-06 Remorin family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027460 259 / 9e-89 AT3G61260 192 / 2e-62 Remorin family protein (.1)
Lus10018840 144 / 4e-43 AT3G61260 206 / 1e-67 Remorin family protein (.1)
Lus10017811 142 / 1e-42 AT3G61260 199 / 5e-65 Remorin family protein (.1)
Lus10014785 131 / 1e-38 AT3G61260 177 / 1e-56 Remorin family protein (.1)
Lus10001477 124 / 2e-35 AT5G23750 162 / 3e-50 Remorin family protein (.1.2)
Lus10008477 120 / 8e-34 AT5G23750 154 / 5e-47 Remorin family protein (.1.2)
Lus10030379 118 / 1e-33 AT3G61260 178 / 4e-57 Remorin family protein (.1)
Lus10008014 114 / 2e-32 AT5G23750 158 / 5e-50 Remorin family protein (.1.2)
Lus10024514 91 / 3e-23 AT5G23750 113 / 5e-32 Remorin family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G081300 161 / 2e-50 AT3G61260 199 / 4e-65 Remorin family protein (.1)
Potri.015G143600 154 / 4e-47 AT5G23750 111 / 1e-30 Remorin family protein (.1.2)
Potri.002G157700 151 / 4e-46 AT3G61260 167 / 2e-52 Remorin family protein (.1)
Potri.012G140800 144 / 2e-43 AT5G23750 98 / 2e-25 Remorin family protein (.1.2)
Potri.003G124400 139 / 2e-41 AT5G23750 129 / 6e-38 Remorin family protein (.1.2)
Potri.001G107000 110 / 3e-30 AT5G23750 55 / 2e-09 Remorin family protein (.1.2)
Potri.008G178300 58 / 5e-10 AT1G67590 306 / 1e-102 Remorin family protein (.1.2)
Potri.006G053200 57 / 6e-10 AT3G57540 196 / 2e-61 Remorin family protein (.1)
Potri.016G054400 57 / 1e-09 AT2G41870 206 / 7e-66 Remorin family protein (.1)
Potri.008G144300 56 / 3e-09 AT2G02170 431 / 5e-147 Remorin family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03766 Remorin_N Remorin, N-terminal region
PF03763 Remorin_C Remorin, C-terminal region
Representative CDS sequence
>Lus10039215 pacid=23175460 polypeptide=Lus10039215 locus=Lus10039215.g ID=Lus10039215.BGIv1.0 annot-version=v1.0
ATGGCAGAGGAAGAAGCTAAGAAGCTCGTCCCTGAATCCCCTGCGGCGGCCACCGTCGTCGTCGAACCTCCCCCGGCCGCTGAAGAGCCTCCAAAGGATG
TTGCTGAGGAGAAATCCGTAATTCCAACTCCTCCTTCTGAAGAAAAACCTGATGATTCCTCCAAGGCCATCGTTCCCCTCCAAAAGGAAGCTGAGCCAGT
TTCAGAGGAGGCAAAGCCTGTTGAGGGATCTGTCAATCGAGATTTGGAGCTGGCCAGAGTAGAAACAGAGAAGAGATTGTCTTTTATCAAAGCCTGGGAA
GAGAGTGAAAAGAGCAAAGCTGAGAACAAGGCTCACAAGAAGGTCTCTGCAATTGAGTCATGGGAGAACAGCAAGAAAGCAGCTGTCGAGGCACAGCTCA
GACAGTACGAGGAAAAACTGGAGAAGCAGAAGGCGGAGTATGCAGAGAAGATGAAGAACAAGATCGCCGAAATCCACAAGCTGGCCGAGGAAAAGAGGGC
CACGATCGAAGCCAAACGAGGCGAAGATATGTTGAAGGCGGAGGAGATGGCTGCAAAGTACCGTGCTACAGGGACGACTCCGAAGAACCCACTTGGCTTC
GGTTGTTTCTGA
AA sequence
>Lus10039215 pacid=23175460 polypeptide=Lus10039215 locus=Lus10039215.g ID=Lus10039215.BGIv1.0 annot-version=v1.0
MAEEEAKKLVPESPAAATVVVEPPPAAEEPPKDVAEEKSVIPTPPSEEKPDDSSKAIVPLQKEAEPVSEEAKPVEGSVNRDLELARVETEKRLSFIKAWE
ESEKSKAENKAHKKVSAIESWENSKKAAVEAQLRQYEEKLEKQKAEYAEKMKNKIAEIHKLAEEKRATIEAKRGEDMLKAEEMAAKYRATGTTPKNPLGF
GCF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G61260 Remorin family protein (.1) Lus10039215 0 1
AT3G61260 Remorin family protein (.1) Lus10027460 1.0 0.8627
Lus10002975 1.7 0.8266
AT3G09740 ATSYP71, SYP71 syntaxin of plants 71 (.1) Lus10019925 3.2 0.8413
AT5G47900 Protein of unknown function (D... Lus10027468 7.7 0.7950
AT5G05840 Protein of unknown function (D... Lus10004669 8.7 0.7600
AT2G44990 MAX3, CCD7, ATC... carotenoid cleavage dioxygenas... Lus10005653 9.7 0.7640
AT5G03470 ATB' ALPHA, ATB... Protein phosphatase 2A regulat... Lus10014417 11.5 0.7764
AT5G03040 IQD2 IQ-domain 2 (.1.2.3) Lus10019916 12.2 0.7809
AT1G56720 Protein kinase superfamily pro... Lus10006215 14.0 0.8038
AT5G27930 Protein phosphatase 2C family ... Lus10015206 14.5 0.7635

Lus10039215 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.