Lus10039216 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G25570 249 / 1e-83 ACYB-2 Cytochrome b561/ferric reductase transmembrane protein family (.1)
AT5G38630 168 / 4e-52 ACYB-1 cytochrome B561-1 (.1)
AT1G14730 114 / 5e-31 Cytochrome b561/ferric reductase transmembrane protein family (.1)
AT1G26100 112 / 4e-30 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027461 351 / 1e-123 AT4G25570 287 / 3e-98 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10038866 285 / 6e-98 AT4G25570 326 / 3e-114 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10014986 283 / 4e-96 AT4G25570 331 / 8e-115 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10003076 140 / 8e-42 AT5G38630 281 / 2e-97 cytochrome B561-1 (.1)
Lus10034074 139 / 1e-39 AT5G38630 287 / 7e-98 cytochrome B561-1 (.1)
Lus10034427 130 / 2e-37 AT1G14730 280 / 4e-96 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10031935 130 / 3e-37 AT1G14730 284 / 8e-98 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10028996 112 / 4e-30 AT4G25570 145 / 4e-43 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Lus10003682 100 / 1e-25 AT4G25570 131 / 1e-37 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G143700 278 / 2e-95 AT4G25570 297 / 8e-103 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.012G141000 268 / 3e-91 AT4G25570 254 / 5e-86 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.017G111700 173 / 6e-54 AT5G38630 321 / 2e-112 cytochrome B561-1 (.1)
Potri.004G103800 171 / 2e-53 AT5G38630 301 / 2e-104 cytochrome B561-1 (.1)
Potri.008G115300 158 / 4e-48 AT5G38630 272 / 7e-93 cytochrome B561-1 (.1)
Potri.010G102400 129 / 5e-37 AT1G14730 271 / 7e-93 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.008G138300 129 / 9e-37 AT1G14730 252 / 2e-85 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.010G131100 115 / 2e-31 AT1G26100 270 / 6e-92 Cytochrome b561/ferric reductase transmembrane protein family (.1)
Potri.008G115200 110 / 1e-29 AT1G26100 270 / 6e-92 Cytochrome b561/ferric reductase transmembrane protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0328 2heme_cytochrom PF03188 Cytochrom_B561 Eukaryotic cytochrome b561
Representative CDS sequence
>Lus10039216 pacid=23175482 polypeptide=Lus10039216 locus=Lus10039216.g ID=Lus10039216.BGIv1.0 annot-version=v1.0
ATGGCTTTAACAGTGAACGCATTACCTTTCACGTTCGTCGCGCACTTGATCGGCATAGCCGCTGCGGTCATGGTTTTGGTCTGGTGCATATATTTCAGAG
GCGGCCTAGCTTGGGAGGATACCAACAAAAACCTTATCTTCAATATTCATCCTGTGCTGATGTTAATCGGCCTTATAATCATAGGAGGCGAAGCAATCAT
AAGCTACAAGTCTCTTCCCCTGAAGAAAGAAGCGAAGAAACTGACCCACCTGATTCTCCACGGCGTTGCACTCATTCTTGGGATCATCGGCATCTACGCA
GCGTTCAAATTCCACAACGAAAGTGGCATCGACAACCTCTACAGCTTACACTCCTGGCTTGGAATTCTCGTCATTTCCCTCTATGGCATCCAGTGGATAT
ATGGGTTGATCATCTTCTTCTACCCAGGAGGATCAAGTACCCTGAGGAAAACATCCATCCCATGGCACGTGTTGCTTGGGCTGTTTATATTTGTGTTAGC
AATAGGCACTGCAGCTATAGGGCTCCTGGAGAAGCTCACATTCCTTGAGAACGGCATCAAACTCCCCAAGTACGGTTCAGAGGCCCTGCTTGTCAACTTC
ACTGCTGTCGTCACAATTCTGTATGGCGCCTTTGTGATACTGTCGGTCCTTGGGCGGAGCCAGGGTAAAGATAGCGGAACCTATTCTGCTATATAA
AA sequence
>Lus10039216 pacid=23175482 polypeptide=Lus10039216 locus=Lus10039216.g ID=Lus10039216.BGIv1.0 annot-version=v1.0
MALTVNALPFTFVAHLIGIAAAVMVLVWCIYFRGGLAWEDTNKNLIFNIHPVLMLIGLIIIGGEAIISYKSLPLKKEAKKLTHLILHGVALILGIIGIYA
AFKFHNESGIDNLYSLHSWLGILVISLYGIQWIYGLIIFFYPGGSSTLRKTSIPWHVLLGLFIFVLAIGTAAIGLLEKLTFLENGIKLPKYGSEALLVNF
TAVVTILYGAFVILSVLGRSQGKDSGTYSAI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G25570 ACYB-2 Cytochrome b561/ferric reducta... Lus10039216 0 1
AT4G23430 AtTic32-IVa translocon at the inner envelo... Lus10014975 1.4 0.9658
AT4G23430 AtTic32-IVa translocon at the inner envelo... Lus10038857 2.0 0.9423
Lus10026628 2.8 0.9327
AT1G75900 EXL3 GDSL-like Lipase/Acylhydrolase... Lus10028425 4.5 0.9230
AT4G25570 ACYB-2 Cytochrome b561/ferric reducta... Lus10027461 6.0 0.9238
AT1G06690 NAD(P)-linked oxidoreductase s... Lus10016327 6.9 0.9374
AT4G39970 Haloacid dehalogenase-like hyd... Lus10023149 7.1 0.9290
AT1G42550 PMI1 plastid movement impaired1 (.1... Lus10002170 7.7 0.9120
AT3G14770 SWEET2, AtSWEET... Nodulin MtN3 family protein (.... Lus10005411 8.8 0.9125
AT4G01935 unknown protein Lus10010062 9.9 0.9186

Lus10039216 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.