Lus10039217 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G19120 78 / 1e-17 Eukaryotic aspartyl protease family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021939 201 / 2e-64 AT5G19120 228 / 4e-71 Eukaryotic aspartyl protease family protein (.1)
Lus10041004 161 / 1e-50 AT5G19120 104 / 4e-26 Eukaryotic aspartyl protease family protein (.1)
Lus10041225 77 / 3e-17 AT1G03220 369 / 2e-125 Eukaryotic aspartyl protease family protein (.1)
Lus10021936 72 / 2e-15 AT1G03220 536 / 0.0 Eukaryotic aspartyl protease family protein (.1)
Lus10021938 71 / 7e-15 AT1G03220 501 / 3e-176 Eukaryotic aspartyl protease family protein (.1)
Lus10041224 69 / 2e-14 AT1G03220 527 / 0.0 Eukaryotic aspartyl protease family protein (.1)
Lus10041223 68 / 4e-14 AT1G03220 525 / 0.0 Eukaryotic aspartyl protease family protein (.1)
Lus10041226 60 / 3e-11 AT1G03220 382 / 1e-130 Eukaryotic aspartyl protease family protein (.1)
Lus10022958 0 / 1 AT1G03230 78 / 3e-17 Eukaryotic aspartyl protease family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G203100 102 / 2e-26 AT1G03220 280 / 3e-90 Eukaryotic aspartyl protease family protein (.1)
Potri.008G203200 76 / 9e-17 AT1G03220 509 / 6e-180 Eukaryotic aspartyl protease family protein (.1)
Potri.006G068900 72 / 1e-15 AT1G03220 456 / 5e-159 Eukaryotic aspartyl protease family protein (.1)
Potri.002G054900 67 / 6e-14 AT1G03220 544 / 0.0 Eukaryotic aspartyl protease family protein (.1)
Potri.019G065100 62 / 4e-12 AT1G03220 298 / 5e-97 Eukaryotic aspartyl protease family protein (.1)
Potri.001G240600 61 / 2e-11 AT1G03230 293 / 4e-95 Eukaryotic aspartyl protease family protein (.1)
Potri.019G064800 60 / 3e-11 AT1G03230 290 / 1e-93 Eukaryotic aspartyl protease family protein (.1)
Potri.019G064700 59 / 4e-11 AT1G03230 291 / 3e-94 Eukaryotic aspartyl protease family protein (.1)
Potri.019G065200 58 / 1e-10 AT1G03230 303 / 4e-99 Eukaryotic aspartyl protease family protein (.1)
Potri.019G065000 57 / 2e-10 AT1G03220 309 / 3e-101 Eukaryotic aspartyl protease family protein (.1)
PFAM info
Representative CDS sequence
>Lus10039217 pacid=23175690 polypeptide=Lus10039217 locus=Lus10039217.g ID=Lus10039217.BGIv1.0 annot-version=v1.0
ATGTTGAACGGCCTGACAAGCGGCGCTCTTGGAATGATCGGATTAGGAGGAAGAAAGAGTCGGATCTCCCCGACGGCGCAGTTCGCGTCAGCATTCGGCT
TCCGAAGCAAGAGGTTCGTCCTCTGCTTTCGAAATTCTGACCTCGGCGTATTGACGTTCGGTGATTCTCCTATTGAATCCGTATTCGGAACAGAGATATC
AAAGTATCTACTTTACACTCCCCTCATTGCCTCCCCTTCCCCTTCCGGCGCCGGATACTTCATCAATCCGAAATCGATCAGAATCGATGGCGAGAAGGTT
TCTGTAAACAAAGATAGAACCTGGTTAACGAAATTAAGTACAACGGTGCCTTGCACTTTAACGGAGAGCTGGTTATACAAAATCTTTGCTCCCACAACCT
TATGCATATCGTAA
AA sequence
>Lus10039217 pacid=23175690 polypeptide=Lus10039217 locus=Lus10039217.g ID=Lus10039217.BGIv1.0 annot-version=v1.0
MLNGLTSGALGMIGLGGRKSRISPTAQFASAFGFRSKRFVLCFRNSDLGVLTFGDSPIESVFGTEISKYLLYTPLIASPSPSGAGYFINPKSIRIDGEKV
SVNKDRTWLTKLSTTVPCTLTESWLYKIFAPTTLCIS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G19120 Eukaryotic aspartyl protease f... Lus10039217 0 1
AT1G59960 NAD(P)-linked oxidoreductase s... Lus10000671 9.3 0.4780
AT2G01050 zinc ion binding;nucleic acid ... Lus10032865 11.1 0.4792
AT4G13420 HAK5, ATHAK5 high affinity K+ transporter 5... Lus10005194 33.8 0.4374
Lus10004853 36.1 0.4374
Lus10027667 38.3 0.4374
Lus10040407 40.4 0.4374
AT5G51030 NAD(P)-binding Rossmann-fold s... Lus10032524 42.3 0.4374
Lus10032828 44.2 0.4374
AT3G04120 GAPC1, GAPC-1, ... glyceraldehyde-3-phosphate deh... Lus10033306 46.0 0.4374
AT4G18340 Glycosyl hydrolase superfamily... Lus10031034 47.8 0.4374

Lus10039217 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.