Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G23760 80 / 3e-21 Copper transport protein family (.1) AT1G01490 48 / 5e-08 Heavy metal transport/detoxification superfamily protein (.1.2) AT5G52740 36 / 0.0004 Copper transport protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001485 [exp] 54 / 4e-11 AT5G23760 54 / 9e-11 Copper transport protein family (.1) Lus10027468 [exp] 49 / 4e-08 AT5G47900 380 / 9e-130 Protein of unknown function (DUF1624) Lus10024672 [exp] 47 / 4e-08 AT1G01490 64 / 1e-13 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10027524 [exp] 49 / 5e-08 AT1G01490 100 / 2e-25 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10028762 [exp] 47 / 9e-08 AT1G01490 74 / 3e-17 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10007911 [exp] 47 / 1e-07 AT1G01490 128 / 2e-37 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10036395 [exp] 47 / 2e-07 AT1G01490 131 / 1e-38 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10039286 [exp] 47 / 2e-07 AT1G01490 97 / 2e-24 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10014967 [exp] 42 / 5e-06 AT1G01490 100 / 9e-27 Heavy metal transport/detoxification superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G144200 [exp] 83 / 1e-21 AT5G23760 96 / 2e-26 Copper transport protein family (.1) Potri.012G141500 [exp] 81 / 1e-21 AT5G23760 92 / 1e-25 Copper transport protein family (.1) Potri.001G099500 [exp] 54 / 1e-10 AT1G01490 105 / 2e-29 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.014G089700 [exp] 52 / 2e-09 AT1G01490 115 / 9e-33 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.003G132200 [exp] 51 / 2e-09 AT1G01490 102 / 2e-28 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.002G163400 [exp] 49 / 1e-08 AT1G01490 110 / 3e-31 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.004G073000 [exp] 48 / 2e-08 AT1G01490 96 / 5e-26 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.017G147500 [exp] 48 / 3e-08 AT1G01490 91 / 4e-24 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.004G073100 [exp] 45 / 3e-07 AT1G01490 82 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.017G147400 [exp] 44 / 7e-07 AT1G01490 74 / 2e-17 Heavy metal transport/detoxification superfamily protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039224 pacid=23175487 polypeptide=Lus10039224 locus=Lus10039224.g ID=Lus10039224.BGIv1.0 annot-version=v1.0 ATGACCGACGAGAAGACCAAGCAGAAAGCGATCGAAGCCGCCGCTGATATCTTCGGGGTGGATTCGATAGCGGCGGATCTGAAGGAGCAGAAGCTGACGG TGATCGGATTGATGGACACGGTGGCGGTGGTGAAGAAGCTGAAGAAAGTTGGTAAAGTTGACATCCTCTCCGTTGGGCCTGCGAAAGAAGAGAAGAAGGA AGAGAAGAAAGAGGAGAAGAAGGATGACGTCAAAAAGGAAGATAAGAAATAA
AA sequence Show only first row Show all	>Lus10039224 pacid=23175487 polypeptide=Lus10039224 locus=Lus10039224.g ID=Lus10039224.BGIv1.0 annot-version=v1.0 MTDEKTKQKAIEAAADIFGVDSIAADLKEQKLTVIGLMDTVAVVKKLKKVGKVDILSVGPAKEEKKEEKKEEKKDDVKKEDKK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G23760			Copper transport protein famil...		Lus10039224 [exp]	0	1
AT2G06530		VPS2.1	SNF7 family protein (.1)		Lus10037660 [exp]	4.9	0.8879
AT1G17455		ELF4-L4	ELF4-like 4 (.1.2)		Lus10000408 [exp]	5.7	0.8990
AT1G04760		ATVAMP726	vesicle-associated membrane pr...		Lus10022804 [exp]	8.9	0.8687
AT5G45130		ATRAB-F2A, RHA1...	ARABIDOPSIS RAB HOMOLOG F2A, R...		Lus10038334 [exp]	11.1	0.8775
AT1G01490			Heavy metal transport/detoxifi...		Lus10007911 [exp]	16.4	0.8560
AT5G16880			Target of Myb protein 1 (.1.2....		Lus10040912 [exp]	17.2	0.8447
					Lus10034731 [exp]	18.8	0.8661
AT5G04750			F1F0-ATPase inhibitor protein,...		Lus10034146 [exp]	22.7	0.8420
AT1G18720			Protein of unknown function (D...		Lus10036771 [exp]	26.5	0.8407
AT2G19830		VPS32, SNF7.2	SNF7 family protein (.1)		Lus10012921 [exp]	31.1	0.8333

Compare expression of checked genes

Lus10039224 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.