Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G48970 168 / 9e-55 Heavy metal transport/detoxification superfamily protein (.1) AT3G56891 81 / 5e-20 Heavy metal transport/detoxification superfamily protein (.1) AT4G08570 67 / 7e-15 Heavy metal transport/detoxification superfamily protein (.1) AT2G18196 66 / 3e-14 Heavy metal transport/detoxification superfamily protein (.1) AT1G71050 66 / 3e-14 HIPP20 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) AT1G06330 61 / 2e-12 Heavy metal transport/detoxification superfamily protein (.1) AT5G66110 59 / 1e-11 HIPP27 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1) AT1G22990 57 / 7e-11 HIPP22 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) AT4G35060 54 / 1e-09 HIPP25 heavy metal associated isoprenylated plant protein 25, Heavy metal transport/detoxification superfamily protein (.1) AT4G10465 54 / 1e-09 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027470 [exp] 221 / 1e-75 AT3G48970 167 / 2e-54 Heavy metal transport/detoxification superfamily protein (.1) Lus10042946 [exp] 66 / 2e-14 AT1G71050 196 / 3e-65 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10014120 [exp] 65 / 8e-14 AT4G38580 253 / 5e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Lus10019789 [exp] 64 / 1e-13 AT4G38580 254 / 4e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Lus10032446 [exp] 64 / 5e-13 AT1G71050 175 / 2e-56 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10020704 [exp] 62 / 7e-13 AT1G06330 173 / 3e-56 Heavy metal transport/detoxification superfamily protein (.1) Lus10016708 [exp] 62 / 1e-12 AT1G71050 192 / 1e-63 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10013911 [exp] 62 / 2e-12 AT1G06330 103 / 2e-28 Heavy metal transport/detoxification superfamily protein (.1) Lus10022508 [exp] 60 / 5e-12 AT4G39700 201 / 2e-67 Heavy metal transport/detoxification superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G144300 [exp] 207 / 4e-70 AT3G48970 180 / 2e-59 Heavy metal transport/detoxification superfamily protein (.1) Potri.011G065600 [exp] 78 / 5e-19 AT1G06330 159 / 7e-51 Heavy metal transport/detoxification superfamily protein (.1) Potri.004G056800 [exp] 76 / 5e-18 AT1G06330 147 / 4e-46 Heavy metal transport/detoxification superfamily protein (.1) Potri.019G107500 [exp] 69 / 1e-15 AT1G06330 213 / 5e-72 Heavy metal transport/detoxification superfamily protein (.1) Potri.019G106500 [exp] 69 / 2e-15 AT1G06330 217 / 1e-73 Heavy metal transport/detoxification superfamily protein (.1) Potri.001G452400 [exp] 63 / 6e-13 AT2G18196 256 / 3e-88 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G167000 [exp] 62 / 1e-12 AT4G08570 229 / 1e-78 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G079800 [exp] 61 / 2e-12 AT4G39700 189 / 2e-62 Heavy metal transport/detoxification superfamily protein (.1) Potri.010G114600 [exp] 61 / 2e-12 AT1G22990 194 / 9e-65 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Potri.011G149500 [exp] 59 / 1e-11 AT2G18196 257 / 9e-89 Heavy metal transport/detoxification superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [flax] [poplar] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Lus10039225 pacid=23175609 polypeptide=Lus10039225 locus=Lus10039225.g ID=Lus10039225.BGIv1.0 annot-version=v1.0 ATGTCTATGGTGGAGGTTAGAGTCCCAAACCTCGACTGTGAAGGCTGCGCTTCCAAGTTGAGGAAAGCTCTCTTAAAACTCAAAGGAGTGGAAGAAGTTG AAGTGGAAATGGAAATTCAGAAGATAACAGTGAGAGGATATTCACTGGAAGAGAAGAAGATTCTCAAGGCGATCAAACGCGCCGGAAAATCGGCTGAGCC ATGGCCGTTCCCCGGCTACGCACACTTCTCGTCGTTTTACAAGTACCCGACCTACATCGTCAACCATTACTACGACCCTTACAAGAACGTGGACGGAGCA GGCGGCAACAACAGCAACAGCGTCCACTCCTTCTTCCAGACGCCGGCGGTGTACTCTGTCGCCGTCGCCTCCGACGAGGCCATTGCGTCCATCTTTAGCG ACGACAATCCACATGCTTGTGCCATAATGTGA
AA sequence Show only first row Show all	>Lus10039225 pacid=23175609 polypeptide=Lus10039225 locus=Lus10039225.g ID=Lus10039225.BGIv1.0 annot-version=v1.0 MSMVEVRVPNLDCEGCASKLRKALLKLKGVEEVEVEMEIQKITVRGYSLEEKKILKAIKRAGKSAEPWPFPGYAHFSSFYKYPTYIVNHYYDPYKNVDGA GGNNSNSVHSFFQTPAVYSVAVASDEAIASIFSDDNPHACAIM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G48970			Heavy metal transport/detoxifi...		Lus10039225 [exp]	0	1
AT3G22810			Plant protein of unknown funct...		Lus10009509 [exp]	4.4	0.8935
AT1G15320			unknown protein		Lus10035916 [exp]	4.9	0.9134
AT1G11120			unknown protein		Lus10039796 [exp]	5.9	0.9295
AT5G52600	MYB	AtMYB82	myb domain protein 82 (.1)		Lus10038092 [exp]	10.9	0.9124
AT5G02560		HTA12	histone H2A 12 (.1.2)		Lus10004945 [exp]	11.8	0.9271
AT2G27990	HD	PNF, BLH8	POUND-FOOLISH, BEL1-like homeo...		Lus10021452 [exp]	13.5	0.9010
AT2G27990	HD	PNF, BLH8	POUND-FOOLISH, BEL1-like homeo...		Lus10016110 [exp]	14.4	0.9017
AT1G01730			unknown protein		Lus10030384 [exp]	17.2	0.8583
AT3G63030		MBD4	methyl-CPG-binding domain 4 (....		Lus10008176 [exp]	17.9	0.9237
AT2G42800		AtRLP29	receptor like protein 29 (.1)		Lus10031383 [exp]	18.0	0.9175

Compare expression of checked genes

Lus10039225 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.