Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G48980 107 / 2e-28 Arabidopsis thaliana protein of unknown function (DUF821) (.1) AT5G23850 98 / 4e-25 Arabidopsis thaliana protein of unknown function (DUF821) (.1) AT1G63420 88 / 1e-21 Arabidopsis thaliana protein of unknown function (DUF821) (.1) AT2G45830 82 / 8e-20 DTA2 downstream target of AGL15 2 (.1.2) AT3G61270 74 / 1e-16 Arabidopsis thaliana protein of unknown function (DUF821) (.1) AT2G45840 63 / 1e-12 Arabidopsis thaliana protein of unknown function (DUF821) (.1) AT3G61290 61 / 3e-12 Arabidopsis thaliana protein of unknown function (DUF821) (.1) AT3G61280 57 / 6e-11 Arabidopsis thaliana protein of unknown function (DUF821) (.1), Arabidopsis thaliana protein of unknown function (DUF821) (.2) AT1G07220 56 / 2e-10 Arabidopsis thaliana protein of unknown function (DUF821) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027472 [exp] 177 / 2e-53 AT5G23850 439 / 4e-147 Arabidopsis thaliana protein of unknown function (DUF821) (.1) Lus10024519 [exp] 94 / 1e-23 AT1G63420 561 / 0.0 Arabidopsis thaliana protein of unknown function (DUF821) (.1) Lus10027473 [exp] 92 / 3e-23 AT1G63420 531 / 0.0 Arabidopsis thaliana protein of unknown function (DUF821) (.1) Lus10037864 [exp] 91 / 2e-22 AT2G45830 520 / 0.0 downstream target of AGL15 2 (.1.2) Lus10039228 [exp] 91 / 2e-22 AT5G23850 657 / 0.0 Arabidopsis thaliana protein of unknown function (DUF821) (.1) Lus10008017 [exp] 73 / 2e-16 AT5G23850 330 / 1e-109 Arabidopsis thaliana protein of unknown function (DUF821) (.1) Lus10037863 [exp] 65 / 2e-13 AT5G23850 446 / 3e-152 Arabidopsis thaliana protein of unknown function (DUF821) (.1) Lus10018239 [exp] 63 / 1e-12 AT1G07220 686 / 0.0 Arabidopsis thaliana protein of unknown function (DUF821) (.1) Lus10040665 [exp] 59 / 2e-11 AT1G07220 688 / 0.0 Arabidopsis thaliana protein of unknown function (DUF821) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G125000 [exp] 122 / 3e-34 AT5G23850 603 / 0.0 Arabidopsis thaliana protein of unknown function (DUF821) (.1) Potri.015G144400 [exp] 121 / 1e-33 AT5G23850 659 / 0.0 Arabidopsis thaliana protein of unknown function (DUF821) (.1) Potri.014G081600 [exp] 94 / 1e-23 AT2G45830 613 / 0.0 downstream target of AGL15 2 (.1.2) Potri.002G157900 [exp] 80 / 7e-19 AT5G23850 537 / 0.0 Arabidopsis thaliana protein of unknown function (DUF821) (.1) Potri.002G157800 [exp] 73 / 3e-16 AT5G23850 513 / 5e-179 Arabidopsis thaliana protein of unknown function (DUF821) (.1) Potri.001G106500 [exp] 62 / 8e-14 AT3G48980 85 / 1e-20 Arabidopsis thaliana protein of unknown function (DUF821) (.1) Potri.001G252000 [exp] 66 / 1e-13 AT1G07220 655 / 0.0 Arabidopsis thaliana protein of unknown function (DUF821) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0113 [flax] [poplar] GT-B PF05686 [flax] [poplar] Glyco_transf_90 Glycosyl transferase family 90
Representative CDS sequence Show only first row Show all	>Lus10039227 pacid=23175491 polypeptide=Lus10039227 locus=Lus10039227.g ID=Lus10039227.BGIv1.0 annot-version=v1.0 ATGGATTACGTGTACGATTACATGCTCCATCTTTTGACTGAGTACTCGAAGCTGCTGACTTTCAAGCCGGTTGTTCCGAGGGGAGGTGTAGAGCTTTGTG CAGAAGAAATGGCTTGCAAAGCGGACGGGATAGAGAAGAAGTTCATGATGGAGTCGTTGGTTAAGGGTCCTTCGGAGACGAGTCCATGCTCGATTCCTCC TCCTTACGACCCTCCATCGCTCGGTAGTATGTTGAGAAGAAACTTGAACTCGGTTAAGCAGGTTGAGTTATGGGAGAAGGGGTACTGGGACAGTCGGAAT ATGCAGCAGACTTAG
AA sequence Show only first row Show all	>Lus10039227 pacid=23175491 polypeptide=Lus10039227 locus=Lus10039227.g ID=Lus10039227.BGIv1.0 annot-version=v1.0 MDYVYDYMLHLLTEYSKLLTFKPVVPRGGVELCAEEMACKADGIEKKFMMESLVKGPSETSPCSIPPPYDPPSLGSMLRRNLNSVKQVELWEKGYWDSRN MQQT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G48980			Arabidopsis thaliana protein o...		Lus10039227 [exp]	0	1
AT1G80600		WIN1	HOPW1-1-interacting 1 (.1)		Lus10031196 [exp]	4.1	0.8852
AT5G23850			Arabidopsis thaliana protein o...		Lus10039226 [exp]	4.9	0.8510
AT4G02340			alpha/beta-Hydrolases superfam...		Lus10018477 [exp]	5.2	0.8612
AT4G16210		ECHIA, E-COAH-2	ENOYL-COA HYDRATASE 2, enoyl-C...		Lus10037777 [exp]	6.3	0.8606
AT2G05830			NagB/RpiA/CoA transferase-like...		Lus10001970 [exp]	10.1	0.8332
AT1G77670			Pyridoxal phosphate (PLP)-depe...		Lus10014710 [exp]	10.2	0.8581
AT5G58730			pfkB-like carbohydrate kinase ...		Lus10018235 [exp]	10.5	0.8716
AT2G05830			NagB/RpiA/CoA transferase-like...		Lus10008417 [exp]	10.7	0.8578
AT4G21350		PUB8, B80	plant U-box 8 (.1)		Lus10006747 [exp]	11.5	0.8426
AT3G62580			Late embryogenesis abundant pr...		Lus10010016 [exp]	14.0	0.8225

Compare expression of checked genes

Lus10039227 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.