Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G64910 59 / 3e-12 UDP-Glycosyltransferase superfamily protein (.1) AT5G54010 59 / 4e-12 UDP-Glycosyltransferase superfamily protein (.1) AT2G22930 58 / 8e-12 UDP-Glycosyltransferase superfamily protein (.1) AT5G53990 57 / 1e-11 UDP-Glycosyltransferase superfamily protein (.1) AT4G27570 57 / 2e-11 UDP-Glycosyltransferase superfamily protein (.1) AT1G64920 56 / 3e-11 UDP-Glycosyltransferase superfamily protein (.1) AT4G27560 56 / 3e-11 UDP-Glycosyltransferase superfamily protein (.1) AT4G09500 56 / 6e-11 UDP-Glycosyltransferase superfamily protein (.1.2) AT3G29630 46 / 1e-07 UDP-Glycosyltransferase superfamily protein (.1) AT1G50580 44 / 1e-06 UDP-Glycosyltransferase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027483 [exp] 91 / 2e-25 AT4G27570 89 / 3e-35 UDP-Glycosyltransferase superfamily protein (.1) Lus10004381 [exp] 91 / 2e-23 AT5G54060 437 / 1e-150 UDP-glucose:flavonoid 3-o-glucosyltransferase (.1) Lus10040178 [exp] 91 / 3e-23 AT5G54010 437 / 7e-151 UDP-Glycosyltransferase superfamily protein (.1) Lus10013368 [exp] 61 / 1e-13 AT4G27570 105 / 6e-34 UDP-Glycosyltransferase superfamily protein (.1) Lus10008453 [exp] 61 / 7e-13 AT5G54010 539 / 0.0 UDP-Glycosyltransferase superfamily protein (.1) Lus10013337 [exp] 60 / 3e-12 AT5G54010 452 / 1e-156 UDP-Glycosyltransferase superfamily protein (.1) Lus10000643 [exp] 52 / 1e-09 AT1G69170 192 / 4e-55 Squamosa promoter-binding protein-like (SBP domain) transcription factor family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G097900 [exp] 62 / 5e-13 AT5G54010 498 / 1e-174 UDP-Glycosyltransferase superfamily protein (.1) Potri.011G061000 [exp] 52 / 1e-09 AT5G54010 468 / 6e-163 UDP-Glycosyltransferase superfamily protein (.1) Potri.006G179700 [exp] 45 / 3e-07 AT5G54010 349 / 2e-116 UDP-Glycosyltransferase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039236 pacid=23175672 polypeptide=Lus10039236 locus=Lus10039236.g ID=Lus10039236.BGIv1.0 annot-version=v1.0 ATGGCGAAGGAGCTGAAGGTGGCCTTGGAAGTCGACAAGGACGAGAATGGGTGGATCAGCAAGGAGAAGGTTTGCAAAGCTATTGGAGCTGTGATGGATG AAGAGAGTGAAGTCGGCAAGGAAGTGACGATGAACCATTTGAAGTGGGGAGAGGTTTTGGGAGATGATCGTTTTTTTGGATGA
AA sequence Show only first row Show all	>Lus10039236 pacid=23175672 polypeptide=Lus10039236 locus=Lus10039236.g ID=Lus10039236.BGIv1.0 annot-version=v1.0 MAKELKVALEVDKDENGWISKEKVCKAIGAVMDEESEVGKEVTMNHLKWGEVLGDDRFFG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G27570			UDP-Glycosyltransferase superf...		Lus10039236 [exp]	0	1
AT5G13160		PBS1	avrPphB susceptible 1, Protein...		Lus10032010 [exp]	1.0	0.9691
AT3G56710		SIB1	sigma factor binding protein 1...		Lus10026165 [exp]	5.5	0.9511
AT3G55500		ATHEXPALPHA1.7,...	EXPANSIN 16, expansin A16 (.1)		Lus10014406 [exp]	7.3	0.9473
					Lus10024445 [exp]	7.5	0.9117
					Lus10042590 [exp]	9.3	0.8715
AT5G15630		IRX6, COBL4	IRREGULAR XYLEM 6, COBRA-LIKE4...		Lus10021142 [exp]	9.4	0.9445
					Lus10036765 [exp]	10.5	0.9445
					Lus10006395 [exp]	11.5	0.9445
AT2G16190			unknown protein		Lus10011284 [exp]	12.4	0.9445
AT5G19450		CPK8, CDPK19	calcium-dependent protein kina...		Lus10030134 [exp]	12.5	0.9249

Compare expression of checked genes

Lus10039236 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.