Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027487 [exp] 78 / 7e-21 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G178400 [exp] 54 / 1e-11 ND / Potri.002G159800 [exp] 37 / 7e-05 ND / Potri.014G084350 [exp] 36 / 0.0002 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039242 pacid=23175687 polypeptide=Lus10039242 locus=Lus10039242.g ID=Lus10039242.BGIv1.0 annot-version=v1.0 ATGGAAGGTGTGATTGATGGAACAGACGGCGGCGGCGGGACGAAGAAGTTAGCTCCGGCGTGCGATGTGGAGGGGCTGAAGAAGTGCTTGGAGGAGAACA AGGGTAACTACGCGAAATGTCAATCGCACATCGAAGCTTTCAAGTCGTCGTGTTCGATAAAGAAACCATGTCCGTCATCGGCAGCGGAGCCTAAGACCAC CGCATAG
AA sequence Show only first row Show all	>Lus10039242 pacid=23175687 polypeptide=Lus10039242 locus=Lus10039242.g ID=Lus10039242.BGIv1.0 annot-version=v1.0 MEGVIDGTDGGGGTKKLAPACDVEGLKKCLEENKGNYAKCQSHIEAFKSSCSIKKPCPSSAAEPKTTA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10039242 [exp]	0	1
AT3G20890			RNA-binding (RRM/RBD/RNP motif...		Lus10030139 [exp]	7.7	0.7316
					Lus10027487 [exp]	13.7	0.6581
AT4G21580			oxidoreductase, zinc-binding d...		Lus10018450 [exp]	15.1	0.7216
AT5G41685			Mitochondrial outer membrane t...		Lus10001641 [exp]	15.2	0.6970
AT3G03100			NADH:ubiquinone oxidoreductase...		Lus10007886 [exp]	16.4	0.6886
AT1G65032			unknown protein		Lus10007103 [exp]	19.0	0.6800
AT5G40190			RNA ligase/cyclic nucleotide p...		Lus10014523 [exp]	19.4	0.7009
AT2G29590			Thioesterase superfamily prote...		Lus10018205 [exp]	24.4	0.7174
AT5G67190	AP2_ERF	DEAR2	DREB and EAR motif protein 2 (...		Lus10009373 [exp]	25.3	0.7130
AT3G01570			Oleosin family protein (.1)		Lus10032127 [exp]	30.0	0.6484

Compare expression of checked genes

Lus10039242 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.