Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G59950 63 / 1e-12 NAD(P)-linked oxidoreductase superfamily protein (.1) AT1G59960 61 / 3e-12 NAD(P)-linked oxidoreductase superfamily protein (.1) AT2G37790 50 / 2e-08 AKR4C10 Aldo-keto reductase family 4 member C10, NAD(P)-linked oxidoreductase superfamily protein (.1) AT5G62420 50 / 2e-08 NAD(P)-linked oxidoreductase superfamily protein (.1) AT2G37770 50 / 3e-08 ChlAKR, AKR4C9 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) AT2G37760 49 / 8e-08 AKR4C8 Aldo-keto reductase family 4 member C8, NAD(P)-linked oxidoreductase superfamily protein AT3G53880 49 / 1e-07 AKR4C11 Aldo-keto reductase family 4 member C11, NAD(P)-linked oxidoreductase superfamily protein (.1) AT2G21250 47 / 4e-07 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) AT2G21260 47 / 5e-07 NAD(P)-linked oxidoreductase superfamily protein (.1) AT5G01670 38 / 0.0005 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029208 [exp] 84 / 3e-20 AT1G59960 406 / 7e-143 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10010720 [exp] 84 / 3e-20 AT1G59960 410 / 2e-144 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10024354 [exp] 56 / 6e-10 AT2G37770 467 / 2e-163 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10021491 [exp] 53 / 3e-09 AT2G37770 464 / 2e-166 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10031739 [exp] 52 / 1e-08 AT5G62420 425 / 2e-150 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10031162 [exp] 51 / 2e-08 AT5G62420 431 / 1e-152 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10027216 [exp] 51 / 2e-08 AT5G62420 429 / 2e-152 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10010884 [exp] 51 / 2e-08 AT2G37770 484 / 5e-174 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Lus10030946 [exp] 50 / 4e-08 AT1G59960 317 / 1e-107 NAD(P)-linked oxidoreductase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G193100 [exp] 71 / 8e-16 AT1G59960 420 / 3e-148 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.005G097000 [exp] 69 / 9e-15 AT1G59960 405 / 2e-142 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.012G039901 [exp] 53 / 1e-09 AT1G59960 201 / 1e-64 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.001G125400 [exp] 52 / 6e-09 AT5G62420 445 / 2e-158 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.016G102100 [exp] 51 / 2e-08 AT2G37770 400 / 5e-141 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.016G102032 [exp] 51 / 2e-08 AT2G37770 424 / 2e-150 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.006G090600 [exp] 50 / 3e-08 AT2G37770 503 / 0.0 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.016G102300 [exp] 49 / 6e-08 AT2G37770 398 / 5e-140 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.017G070600 [exp] 46 / 8e-07 AT2G37770 438 / 6e-156 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.009G125100 [exp] 45 / 3e-06 AT2G21250 526 / 0.0 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039266 pacid=23175515 polypeptide=Lus10039266 locus=Lus10039266.g ID=Lus10039266.BGIv1.0 annot-version=v1.0 ATGGAGGAGTGTCGGAGTATCGGGCTGACGAAGAACATCGGTGTCAGCAATTTCACCTGCAAGAAGCTTACGGATCTACTAGCTATTGCCAAGATCCCAC CTGCTGTGAATCAAATTCGACCAAGGTTCCACCGCAAAAAGGGCTTCGTCGTCAAACATCCAACTTCGCCGGCGGGGAAATCGCTGCAACTACAGCAGCT TGGTGTCGCTAGGAATCTGAAGAGCAACGAACTGACCGATGAGATTCCATCCCGACTCTGCCGCCGATTCGCCGTCATCCTGGGATCTGAACAGAAGCGG CGGTGTCGAGGGAGAAAAGGCAGGTACATAATAGCCTTGGGGTAA
AA sequence Show only first row Show all	>Lus10039266 pacid=23175515 polypeptide=Lus10039266 locus=Lus10039266.g ID=Lus10039266.BGIv1.0 annot-version=v1.0 MEECRSIGLTKNIGVSNFTCKKLTDLLAIAKIPPAVNQIRPRFHRKKGFVVKHPTSPAGKSLQLQQLGVARNLKSNELTDEIPSRLCRRFAVILGSEQKR RCRGRKGRYIIALG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G59950			NAD(P)-linked oxidoreductase s...		Lus10039266 [exp]	0	1
AT1G27340			Galactose oxidase/kelch repeat...		Lus10003117 [exp]	1.0	0.9226
AT5G61280			Remorin family protein (.1)		Lus10034714 [exp]	2.0	0.8891
AT5G49810		MMT	methionine S-methyltransferase...		Lus10038132 [exp]	2.4	0.8869
					Lus10000538 [exp]	3.0	0.8769
					Lus10024086 [exp]	3.5	0.8604
AT3G18590		AtENODL5	early nodulin-like protein 5 (...		Lus10022318 [exp]	3.7	0.8551
AT1G65910	NAC	ANAC028	NAC domain containing protein ...		Lus10010959 [exp]	4.5	0.8713
AT3G15200			Tetratricopeptide repeat (TPR)...		Lus10031269 [exp]	5.1	0.8559
AT4G26110		NAP1;1, ATNAP1;...	ARABIDOPSIS THALIANA NUCLEOSOM...		Lus10042106 [exp]	6.0	0.8946
AT3G52420		ATOEP7	outer envelope membrane protei...		Lus10003733 [exp]	6.5	0.8839

Compare expression of checked genes

Lus10039266 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.