Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59310 62 / 1e-13 LTP4 lipid transfer protein 4 (.1) AT4G33355 60 / 1e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G18370 58 / 5e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G38540 57 / 2e-11 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) AT5G59320 54 / 1e-10 LTP3 lipid transfer protein 3 (.1) AT2G38530 54 / 3e-10 cdf3, LP2, LTP2 cell growth defect factor-3, lipid transfer protein 2 (.1) AT3G51590 52 / 8e-10 LTP12 lipid transfer protein 12 (.1) AT3G08770 51 / 3e-09 LTP6 lipid transfer protein 6 (.1.2) AT2G15050 51 / 3e-09 LTP7, LTP lipid transfer protein 7, lipid transfer protein (.1.2.3) AT5G01870 48 / 4e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042512 [exp] 169 / 5e-56 AT2G18370 64 / 2e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10031282 [exp] 165 / 1e-54 AT4G33355 56 / 1e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10031851 [exp] 168 / 6e-54 AT5G58510 109 / 2e-27 unknown protein Lus10032716 [exp] 90 / 6e-25 AT4G33355 42 / 2e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10009630 [exp] 82 / 1e-20 AT3G51590 59 / 5e-12 lipid transfer protein 12 (.1) Lus10009003 [exp] 78 / 2e-19 AT3G51590 59 / 5e-12 lipid transfer protein 12 (.1) Lus10026418 [exp] 69 / 6e-16 AT5G59320 115 / 2e-34 lipid transfer protein 3 (.1) Lus10001703 [exp] 67 / 3e-15 AT4G33355 86 / 9e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10025234 [exp] 65 / 2e-14 AT2G38530 118 / 2e-35 cell growth defect factor-3, lipid transfer protein 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G232700 [exp] 66 / 5e-15 AT2G18370 93 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232900 [exp] 65 / 1e-14 AT2G18370 100 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135700 [exp] 61 / 7e-13 AT5G59310 92 / 3e-25 lipid transfer protein 4 (.1) Potri.006G108100 [exp] 59 / 3e-12 AT2G38540 121 / 6e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.016G135400 [exp] 59 / 4e-12 AT5G59320 109 / 3e-32 lipid transfer protein 3 (.1) Potri.014G046500 [exp] 58 / 6e-12 AT4G33355 76 / 6e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.016G135500 [exp] 57 / 1e-11 AT5G59320 94 / 8e-26 lipid transfer protein 3 (.1) Potri.009G025200 [exp] 53 / 6e-10 AT2G18370 86 / 6e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.011G021900 [exp] 51 / 3e-09 AT3G08770 60 / 8e-13 lipid transfer protein 6 (.1.2) Potri.004G086600 [exp] 50 / 1e-08 AT2G38540 122 / 3e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10039270 pacid=23175639 polypeptide=Lus10039270 locus=Lus10039270.g ID=Lus10039270.BGIv1.0 annot-version=v1.0 ATGAACAAGACTTTTTTCTCACTTTTCATCATCGTCATCTTTTCTTCCTTCTCTGTTTCTCTCGCCAATCATAAAGGTGAAGTAGCTTCTATCACTTGTA GTACGGTTGATGACGATGCACGGCCGTGTTTACCATACGCTACCGGCAAAAGCAACTCAATAGCACCAGATTGTTGCTCCGGCCTCCATAATTTGATCGC AAGTACATCTACTATCGACGACAAGAAGATAGCTTGCAATTGTCTCGTCACTGCTTTCAAGATCTTTCCAGTACATGATGACTTATTGAAAAAGATTCCA GACTTGTGCAAACTTGAAGTTCCTTTCAACATGTCAACAACCGTCAACTGTGACAAGTAA
AA sequence Show only first row Show all	>Lus10039270 pacid=23175639 polypeptide=Lus10039270 locus=Lus10039270.g ID=Lus10039270.BGIv1.0 annot-version=v1.0 MNKTFFSLFIIVIFSSFSVSLANHKGEVASITCSTVDDDARPCLPYATGKSNSIAPDCCSGLHNLIASTSTIDDKKIACNCLVTAFKIFPVHDDLLKKIP DLCKLEVPFNMSTTVNCDK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59310		LTP4	lipid transfer protein 4 (.1)		Lus10039270 [exp]	0	1
AT2G48020			Major facilitator superfamily ...		Lus10027975 [exp]	15.1	0.8545
AT5G58040		FIP1[V], ATFIP1...	homolog of yeast FIP1 [V], hom...		Lus10040031 [exp]	23.1	0.8295
AT2G29420		GST25, ATGSTU7	GLUTATHIONE S-TRANSFERASE 25, ...		Lus10001640 [exp]	27.2	0.8210
AT2G03530		ATUPS2, UPS2	ARABIDOPSIS THALIANA UREIDE PE...		Lus10037075 [exp]	29.9	0.8333
AT1G08230		ATGAT1	L-GAMMA-AMINOBUTYRIC ACID TRAN...		Lus10009386 [exp]	30.4	0.8263
AT4G21510			F-box family protein (.1)		Lus10011255 [exp]	41.2	0.8192
AT3G61980			serine protease inhibitor, Kaz...		Lus10010285 [exp]	43.1	0.8263
AT1G33030			O-methyltransferase family pro...		Lus10009442 [exp]	47.4	0.8267
AT5G04260		WCRKC2	WCRKC thioredoxin 2 (.1)		Lus10037975 [exp]	49.8	0.8187
AT1G69490	NAC	NAP, ANAC029, A...	Arabidopsis NAC domain contain...		Lus10030446 [exp]	71.2	0.8086

Compare expression of checked genes

Lus10039270 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.