Lus10039285 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G52730 48 / 3e-07 Copper transport protein family (.1)
AT1G01490 48 / 3e-07 Heavy metal transport/detoxification superfamily protein (.1.2)
AT5G52760 43 / 6e-06 Copper transport protein family (.1)
AT5G52740 40 / 7e-05 Copper transport protein family (.1)
AT5G52750 38 / 0.0007 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027522 110 / 7e-32 AT1G01490 83 / 7e-21 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10027523 85 / 1e-21 AT1G01490 77 / 3e-19 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10039286 81 / 6e-19 AT1G01490 97 / 2e-24 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10027524 78 / 2e-17 AT1G01490 100 / 2e-25 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10014967 61 / 4e-12 AT1G01490 100 / 9e-27 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10007911 54 / 3e-09 AT1G01490 128 / 2e-37 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10036395 53 / 7e-09 AT1G01490 131 / 1e-38 Heavy metal transport/detoxification superfamily protein (.1.2)
Lus10007455 52 / 4e-08 AT3G44480 98 / 1e-20 recognition of peronospora parasitica 1, Disease resistance protein (TIR-NBS-LRR class) family (.1)
Lus10017520 49 / 9e-08 AT1G01490 52 / 3e-09 Heavy metal transport/detoxification superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G147500 67 / 6e-15 AT1G01490 91 / 4e-24 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.001G099500 67 / 7e-15 AT1G01490 105 / 2e-29 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.003G132200 66 / 4e-14 AT1G01490 102 / 2e-28 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.017G147400 65 / 5e-14 AT1G01490 74 / 2e-17 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.004G073100 62 / 7e-13 AT1G01490 82 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.004G073000 62 / 9e-13 AT1G01490 96 / 5e-26 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.017G147200 58 / 2e-11 AT1G01490 64 / 1e-13 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.017G147000 58 / 2e-11 AT1G01490 61 / 2e-12 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.002G163400 54 / 1e-09 AT1G01490 110 / 3e-31 Heavy metal transport/detoxification superfamily protein (.1.2)
Potri.017G145516 50 / 1e-08 AT1G01490 56 / 7e-11 Heavy metal transport/detoxification superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00403 HMA Heavy-metal-associated domain
Representative CDS sequence
>Lus10039285 pacid=23175467 polypeptide=Lus10039285 locus=Lus10039285.g ID=Lus10039285.BGIv1.0 annot-version=v1.0
ATGACAAACCTTCATCTAAATCTCATCATCAAACCAACCAATTACTCCACCAATCTCAATTCACCATCTCATCCTCTCAACTTAATTCTTAATCGCAATC
ATGAAGGCACGTACCAAGTGGTGCTTAAGCTGGATCTACGCGACGACAAAGACAAGCAGAGAGCACTGAAGCGAGTAACGGGCACCTCGGGGGTTGACTC
GATCTCCGTGGACATGAAGGAGAACAAGATGATGGTGACCGGAGACTTTGACCCGGTTGAAGTTGTGAGCAAACTGAGGAAGCTTTATCACACGGTCATA
GTCTCCGTCGGGGAGCCCAAGAAGGACCCTGAACCGATGGTAACAGTACAGTACTATGGCTACGTCTACGGCTACTATCCTGATCACCACAATAGCTACA
ACTCGTACGGACGCTATGATCAAGTGGTTGCGGGGGATGACGGGGGATGGCCCTAA
AA sequence
>Lus10039285 pacid=23175467 polypeptide=Lus10039285 locus=Lus10039285.g ID=Lus10039285.BGIv1.0 annot-version=v1.0
MTNLHLNLIIKPTNYSTNLNSPSHPLNLILNRNHEGTYQVVLKLDLRDDKDKQRALKRVTGTSGVDSISVDMKENKMMVTGDFDPVEVVSKLRKLYHTVI
VSVGEPKKDPEPMVTVQYYGYVYGYYPDHHNSYNSYGRYDQVVAGDDGGWP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G01490 Heavy metal transport/detoxifi... Lus10039285 0 1
Lus10023082 2.2 0.8126
AT5G44510 TAO1 target of AVRB operation1 (.1) Lus10011242 6.0 0.7759
AT5G36930 Disease resistance protein (TI... Lus10025497 7.5 0.7040
AT1G01490 Heavy metal transport/detoxifi... Lus10027522 15.8 0.7874
AT1G13110 CYP71B7 "cytochrome P450, family 71 su... Lus10042815 16.1 0.7706
AT2G18660 AtPNP-A, PNP-A,... plant natriuretic peptide A (.... Lus10031759 16.3 0.6500
AT5G48290 Heavy metal transport/detoxifi... Lus10025180 19.6 0.6988
AT3G16030 CES101 CALLUS EXPRESSION OF RBCS 101,... Lus10003156 25.1 0.7599
AT4G12010 Disease resistance protein (TI... Lus10015350 27.0 0.7106
AT5G59320 LTP3 lipid transfer protein 3 (.1) Lus10009911 27.3 0.7560

Lus10039285 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.