Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G16520 81 / 3e-19 UGT88A1 UDP-glucosyl transferase 88A1 (.1.2.3) AT4G01070 57 / 1e-10 UGT72B1, GT72B1 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2) AT2G29740 49 / 3e-08 UGT71C2 UDP-glucosyl transferase 71C2 (.1) AT1G01390 49 / 4e-08 UDP-Glycosyltransferase superfamily protein (.1) AT1G07260 47 / 2e-07 UGT71C3 UDP-glucosyl transferase 71C3 (.1) AT3G21790 47 / 3e-07 UDP-Glycosyltransferase superfamily protein (.1) AT1G07240 46 / 4e-07 UGT71C5 UDP-glucosyl transferase 71C5 (.1) AT1G07250 44 / 2e-06 UGT71C4 UDP-glucosyl transferase 71C4 (.1) AT3G21780 44 / 3e-06 UGT71B6 UDP-glucosyl transferase 71B6 (.1) AT3G21750 44 / 3e-06 UGT71B1 UDP-glucosyl transferase 71B1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027542 [exp] 130 / 3e-37 AT3G16520 431 / 3e-148 UDP-glucosyl transferase 88A1 (.1.2.3) Lus10039301 [exp] 116 / 4e-32 AT3G16520 481 / 9e-168 UDP-glucosyl transferase 88A1 (.1.2.3) Lus10005951 [exp] 56 / 2e-10 AT4G01070 510 / 5e-179 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2) Lus10005950 [exp] 55 / 5e-10 AT4G01070 573 / 0.0 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2) Lus10003900 [exp] 55 / 5e-10 AT4G01070 411 / 4e-140 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2) Lus10001906 [exp] 54 / 1e-09 AT4G01070 431 / 1e-147 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2) Lus10039302 [exp] 54 / 1e-09 AT3G16520 393 / 2e-133 UDP-glucosyl transferase 88A1 (.1.2.3) Lus10029453 [exp] 53 / 2e-09 AT4G01070 515 / 0.0 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2) Lus10029452 [exp] 52 / 3e-09 AT4G01070 582 / 0.0 UDP-GLUCOSE-DEPENDENT GLUCOSYLTRANSFERASE 72 B1, UDP-Glycosyltransferase superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G071000 [exp] 88 / 6e-22 AT3G16520 485 / 2e-169 UDP-glucosyl transferase 88A1 (.1.2.3) Potri.017G150100 [exp] 87 / 2e-21 AT3G16520 451 / 9e-156 UDP-glucosyl transferase 88A1 (.1.2.3) Potri.004G070900 [exp] 86 / 4e-21 AT3G16520 478 / 2e-166 UDP-glucosyl transferase 88A1 (.1.2.3) Potri.004G069600 [exp] 84 / 1e-20 AT3G16520 498 / 2e-174 UDP-glucosyl transferase 88A1 (.1.2.3) Potri.017G150000 [exp] 84 / 2e-20 AT3G16520 503 / 1e-176 UDP-glucosyl transferase 88A1 (.1.2.3) Potri.004G070000 [exp] 82 / 1e-19 AT3G16520 474 / 4e-165 UDP-glucosyl transferase 88A1 (.1.2.3) Potri.004G069700 [exp] 77 / 4e-18 AT3G16520 361 / 2e-122 UDP-glucosyl transferase 88A1 (.1.2.3) Potri.004G069800 [exp] 74 / 9e-17 AT3G16520 496 / 7e-174 UDP-glucosyl transferase 88A1 (.1.2.3) Potri.015G027800 [exp] 72 / 3e-16 AT3G16520 355 / 1e-118 UDP-glucosyl transferase 88A1 (.1.2.3) Potri.015G027700 [exp] 72 / 3e-16 AT3G16520 339 / 3e-112 UDP-glucosyl transferase 88A1 (.1.2.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039300 pacid=23175634 polypeptide=Lus10039300 locus=Lus10039300.g ID=Lus10039300.BGIv1.0 annot-version=v1.0 ATGGTGGCATGGCCATTATACGCGGAACAGAAGTTAAATCGAGTGATGGTGGTGGAGGAGATTAAGATTGCATTGTCGATGGAAGGGAGCGACGATAGTG GGTTTGTGAAAGCGGAGGAGGTGGAGAGGCGAGTTAAGGAGTTGATGGGATTGGAGGGAAGAGGTGAGTTGGTGAAGCGTCAAACGATTGAGATGAAGAA TGCGGCGGAGTGTGCAGTGGGGGACGGTGGTTCTTCTAGTGTGGCGTTGAATCAACTCATCGATTCGTGGACCGGAAAATAA
AA sequence Show only first row Show all	>Lus10039300 pacid=23175634 polypeptide=Lus10039300 locus=Lus10039300.g ID=Lus10039300.BGIv1.0 annot-version=v1.0 MVAWPLYAEQKLNRVMVVEEIKIALSMEGSDDSGFVKAEEVERRVKELMGLEGRGELVKRQTIEMKNAAECAVGDGGSSSVALNQLIDSWTGK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G16520		UGT88A1	UDP-glucosyl transferase 88A1 ...		Lus10039300 [exp]	0	1
AT3G09925			Pollen Ole e 1 allergen and ex...		Lus10014394 [exp]	2.8	0.9032
AT2G45550		CYP76C4	"cytochrome P450, family 76, s...		Lus10008918 [exp]	3.3	0.9362
AT1G16130		WAKL2	wall associated kinase-like 2 ...		Lus10003063 [exp]	9.6	0.9163
AT5G06720		ATPA2	peroxidase 2 (.1)		Lus10008168 [exp]	10.4	0.9355
					Lus10019813 [exp]	10.5	0.8460
AT5G13930		ATCHS, TT4, CHS	TRANSPARENT TESTA 4, CHALCONE ...		Lus10031622 [exp]	26.0	0.9073
AT5G06860		ATPGIP1, PGIP1	polygalacturonase inhibiting p...		Lus10021029 [exp]	29.5	0.9033
					Lus10021010 [exp]	29.7	0.9093
AT1G71520	AP2_ERF		Integrase-type DNA-binding sup...		Lus10041044 [exp]	32.8	0.9151
AT3G06180			Ribosomal protein L34e superfa...		Lus10004432 [exp]	38.7	0.8692

Compare expression of checked genes

Lus10039300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.