Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G25750 124 / 7e-33 ABCG4 ATP-binding cassette G4, ABC-2 type transporter family protein (.1) AT5G52860 117 / 3e-30 ABCG8 ATP-binding cassette G8, ABC-2 type transporter family protein (.1) AT2G13610 85 / 6e-19 ABCG5 ATP-binding cassette G5, ABC-2 type transporter family protein (.1) AT1G53270 78 / 2e-16 ABCG10 ATP-binding cassette G10, ABC-2 type transporter family protein (.1) AT5G19410 74 / 2e-15 ABCG23 ATP-binding cassette G23, ABC-2 type transporter family protein (.1) AT3G55100 66 / 3e-12 ABCG17 ATP-binding cassette G17, ABC-2 type transporter family protein (.1) AT5G06530 64 / 7e-12 AtABCG22, ABCG22 Arabidopsis thaliana ATP-binding cassette G22, ATP-binding cassette G22, ABC-2 type transporter family protein (.1.2.3) AT2G39350 64 / 1e-11 ABCG1 ATP-binding cassette G1, ABC-2 type transporter family protein (.1) AT3G55090 64 / 1e-11 ABCG16 ATP-binding cassette G16, ABC-2 type transporter family protein (.1) AT3G53510 64 / 2e-11 ABCG20 ATP-binding cassette G20, ABC-2 type transporter family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027545 [exp] 208 / 1e-63 AT5G52860 781 / 0.0 ATP-binding cassette G8, ABC-2 type transporter family protein (.1) Lus10029905 [exp] 83 / 5e-18 AT2G13610 743 / 0.0 ATP-binding cassette G5, ABC-2 type transporter family protein (.1) Lus10004496 [exp] 81 / 1e-17 AT2G13610 729 / 0.0 ATP-binding cassette G5, ABC-2 type transporter family protein (.1) Lus10008500 [exp] 73 / 9e-15 AT5G19410 758 / 0.0 ATP-binding cassette G23, ABC-2 type transporter family protein (.1) Lus10000737 [exp] 73 / 1e-14 AT5G19410 754 / 0.0 ATP-binding cassette G23, ABC-2 type transporter family protein (.1) Lus10039859 [exp] 72 / 2e-14 AT2G37360 319 / 5e-97 ATP-binding cassette G2, ABC-2 type transporter family protein (.1) Lus10033637 [exp] 70 / 8e-14 AT5G19410 735 / 0.0 ATP-binding cassette G23, ABC-2 type transporter family protein (.1) Lus10017683 [exp] 69 / 3e-13 AT5G19410 731 / 0.0 ATP-binding cassette G23, ABC-2 type transporter family protein (.1) Lus10017707 [exp] 67 / 9e-13 AT2G37360 456 / 6e-151 ATP-binding cassette G2, ABC-2 type transporter family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G027600 [exp] 154 / 1e-43 AT5G52860 733 / 0.0 ATP-binding cassette G8, ABC-2 type transporter family protein (.1) Potri.011G112100 [exp] 82 / 4e-18 AT1G53270 753 / 0.0 ATP-binding cassette G10, ABC-2 type transporter family protein (.1) Potri.005G064300 [exp] 82 / 5e-18 AT2G13610 900 / 0.0 ATP-binding cassette G5, ABC-2 type transporter family protein (.1) Potri.001G393300 [exp] 82 / 1e-17 AT1G53270 756 / 0.0 ATP-binding cassette G10, ABC-2 type transporter family protein (.1) Potri.013G117700 [exp] 81 / 1e-17 AT1G53270 666 / 0.0 ATP-binding cassette G10, ABC-2 type transporter family protein (.1) Potri.007G104801 [exp] 81 / 2e-17 AT2G13610 949 / 0.0 ATP-binding cassette G5, ABC-2 type transporter family protein (.1) Potri.009G070100 [exp] 74 / 5e-15 AT5G19410 707 / 0.0 ATP-binding cassette G23, ABC-2 type transporter family protein (.1) Potri.012G045100 [exp] 72 / 1e-14 AT3G55130 270 / 3e-79 ATP-binding cassette G19, white-brown complex homolog 19 (.1) Potri.015G036100 [exp] 71 / 6e-14 AT2G37360 276 / 2e-81 ATP-binding cassette G2, ABC-2 type transporter family protein (.1) Potri.008G047900 [exp] 66 / 2e-12 AT3G55090 1008 / 0.0 ATP-binding cassette G16, ABC-2 type transporter family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00005 [flax] [poplar] ABC_tran ABC transporter
Representative CDS sequence Show only first row Show all	>Lus10039305 pacid=23175477 polypeptide=Lus10039305 locus=Lus10039305.g ID=Lus10039305.BGIv1.0 annot-version=v1.0 ATGGATGAAACTCAACCACAACCACCACCTCCAAACCCTCCTCCACCACCACCACCACCCAAAATTACTACTCACAAGCTCACAGCCTCATCAATCTCCT ACTCCAAATCCACCACCACCTCCTCCTCCACCACCGCCACATCACCATTCCACCTCCTCTTCAAACCATGCTCCTCCACCCCACCAACCACCATCCTCAA CAATGTCTCCTTCACCGCCTTCCCCTCCGAAATCCTCGCCATTGTTGGACCCAGTGGGGCCGGAAAGTCCACCCTCCTCGACATCCTCGCAGCTCGAACC TCCCCTACCACCGGCTCCCTCCTCCTCAACTCATCCCCCATCAACCCTTCCTCCTTCCGCAAGCTCTCCGCCTATGTCCCCCAACACGACGCTTCCCTCC CTCTCCTCACCGTCTTTGAGACCTTCGCCTTCTCCGCCCGCCTCCTAAACCCTACTTCCTCCTCGGGAATCCCAACCCTAGTAGCCTCCCTCCTCGAAGA GCTCTCCCTGGCCCACGTGGCGAACATCAGGCTGGCCGAGGGAAAACTCTCCGGCGGAGAGCGAGAGTCTCCATCGGCCTGGCAGTACTTCACGACCCTG GAGTACTGCTCCTCGACGAGCCGACTTCTGGCCTGGACAGCAAGTCAGCTCTCAGCGTGGTCCAAACCGTGA
AA sequence Show only first row Show all	>Lus10039305 pacid=23175477 polypeptide=Lus10039305 locus=Lus10039305.g ID=Lus10039305.BGIv1.0 annot-version=v1.0 MDETQPQPPPPNPPPPPPPPKITTHKLTASSISYSKSTTTSSSTTATSPFHLLFKPCSSTPPTTILNNVSFTAFPSEILAIVGPSGAGKSTLLDILAART SPTTGSLLLNSSPINPSSFRKLSAYVPQHDASLPLLTVFETFAFSARLLNPTSSSGIPTLVASLLEELSLAHVANIRLAEGKLSGGERESPSAWQYFTTL EYCSSTSRLLAWTASQLSAWSKP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G52860		ABCG8	ATP-binding cassette G8, ABC-2...		Lus10039305 [exp]	0	1
AT5G52860		ABCG8	ATP-binding cassette G8, ABC-2...		Lus10039304 [exp]	2.0	0.9314
AT2G21060		ATCSP4, ATGRP2B	COLD SHOCK DOMAIN PROTEIN 4, g...		Lus10025058 [exp]	4.7	0.9072
AT2G26460		SMU2	SUPPRESSORS OF MEC-8 AND UNC-5...		Lus10039918 [exp]	6.9	0.8685
AT5G26749			C2H2 and C2HC zinc fingers sup...		Lus10001520 [exp]	7.4	0.8772
AT2G01630			O-Glycosyl hydrolases family 1...		Lus10007929 [exp]	9.8	0.8622
AT1G28290		AGP31	arabinogalactan protein 31 (.1...		Lus10015434 [exp]	11.6	0.8821
AT3G09430			unknown protein		Lus10000245 [exp]	11.9	0.8076
AT1G76860			Small nuclear ribonucleoprotei...		Lus10040487 [exp]	12.0	0.8598
AT2G36660		PAB7	poly(A) binding protein 7 (.1)		Lus10027733 [exp]	13.6	0.8304
AT2G36400	GRF	ATGRF3	growth-regulating factor 3 (.1...		Lus10023877 [exp]	15.9	0.8795

Compare expression of checked genes

Lus10039305 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.