Lus10039310 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G22470 210 / 6e-64 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G63400 199 / 4e-60 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G12300 200 / 5e-60 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G63080 199 / 6e-60 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G63150 199 / 8e-60 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G62930 196 / 2e-58 RPF3 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G12620 195 / 2e-58 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G12775 195 / 4e-58 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G63130 194 / 5e-58 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G16640 188 / 2e-56 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024962 346 / 2e-117 AT1G62680 346 / 3e-113 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10022861 342 / 4e-115 AT1G12700 370 / 7e-121 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Lus10014242 325 / 2e-110 AT1G62930 256 / 5e-78 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10014247 328 / 1e-109 AT1G62930 340 / 3e-109 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10003433 326 / 1e-108 AT1G12700 396 / 2e-129 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Lus10014244 323 / 8e-108 AT1G12700 397 / 7e-130 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Lus10014245 321 / 6e-107 AT1G12700 427 / 5e-141 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Lus10008593 317 / 2e-105 AT1G12700 400 / 7e-131 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Lus10009201 293 / 2e-99 AT1G12700 274 / 3e-86 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G047400 239 / 4e-76 AT1G63080 341 / 1e-110 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G038400 239 / 3e-75 AT1G12700 478 / 7e-161 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.006G257300 238 / 8e-75 AT1G62930 481 / 3e-163 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.005G046200 238 / 1e-74 AT1G12700 501 / 5e-170 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.004G074700 234 / 4e-74 AT1G62930 481 / 1e-164 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.005G045000 234 / 5e-73 AT1G12700 502 / 4e-170 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G046100 233 / 2e-72 AT1G12700 512 / 1e-173 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.013G149800 232 / 4e-72 AT1G12700 482 / 6e-162 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G050400 230 / 1e-71 AT1G12700 504 / 3e-171 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.006G271400 229 / 2e-71 AT1G12700 486 / 3e-164 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10039310 pacid=23175580 polypeptide=Lus10039310 locus=Lus10039310.g ID=Lus10039310.BGIv1.0 annot-version=v1.0
ATGAAGGTGTTAGAAATGAATGCCGTTCCTAATGTCGTCACCTTTAACATTTTGATTGACTCTTCTTGCAAAGAGGGAAGGGTTCTTGAGGCTAAAGTTA
TACTTAAAAAAATTATTCAAAGAGGGTTGCATCCAACTATCTTGACATTCAATTCATTGCTTGATGGGTATTGTTTGCGTAATGAATTAGACAAAGCTCA
TAAATTATTTATTTTCATGGTCAGTAAAGGATGCAAGCCTAATGTTCATACATATACTATCATGATCAATGGATATTGTAAGAGTGAAAGGTTGGGTGAG
GCCAAAGAGTTACCGAATGATATGCTTGAAAAGGGTTTAGCTCCGAACACTGTTACATACAGAGCTCTTCTGGATGGGTTTTGCCGAGCAGGGAGGCTCA
AGGCTGCGCAAACACTTTTCAAGAAAACGTGTGATCAAGGACAAATTCCAGGTGTCGTGACATGCGGCAGTTTGCTAAGTGGCTGGTGCGGAGGAGGTAA
TATTGACGAGGCTATAGCTCTATTTCAACAAATGGAGAGTAGTTGGTTGAAGCCTAATGTTGCGGTCTATAATATTCTTATTGATGGTATGTGGAAAGCA
GGAAGGGTTAAGGAAGCTAGAGACATGTTTTCTAAGCTCTCTCAAAATGAGAGTTTACAACTTGATATCCGCACATATAACTTAGTAATTGATGGACTTT
GTAGACATGGTTTGGTTGATGAATATGATCTGTTCAGAACAATGGAGAAGAGTATTTTTCACTAG
AA sequence
>Lus10039310 pacid=23175580 polypeptide=Lus10039310 locus=Lus10039310.g ID=Lus10039310.BGIv1.0 annot-version=v1.0
MKVLEMNAVPNVVTFNILIDSSCKEGRVLEAKVILKKIIQRGLHPTILTFNSLLDGYCLRNELDKAHKLFIFMVSKGCKPNVHTYTIMINGYCKSERLGE
AKELPNDMLEKGLAPNTVTYRALLDGFCRAGRLKAAQTLFKKTCDQGQIPGVVTCGSLLSGWCGGGNIDEAIALFQQMESSWLKPNVAVYNILIDGMWKA
GRVKEARDMFSKLSQNESLQLDIRTYNLVIDGLCRHGLVDEYDLFRTMEKSIFH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G22470 Pentatricopeptide repeat (PPR)... Lus10039310 0 1
AT1G59171 Inositol-pentakisphosphate 2-k... Lus10033202 20.4 0.8286
AT2G47810 CCAAT NF-YB5 "nuclear factor Y, subunit B5"... Lus10041355 39.2 0.8188
AT1G47670 Transmembrane amino acid trans... Lus10025113 65.1 0.7673
AT4G01070 UGT72B1, GT72B1 UDP-GLUCOSE-DEPENDENT GLUCOSYL... Lus10029453 164.3 0.7637

Lus10039310 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.