Lus10039311 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G06430 358 / 7e-123 AtPPR2, EMB2750 pentatricopeptide repeat 2, embryo defective 2750, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G48730 231 / 3e-73 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G53170 213 / 4e-66 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G39620 122 / 4e-32 ATPPR5, EMB2453 EMBRYO DEFECTIVE 2453, A. THALIANA PENTATRICOPEPTIDE REPEAT 5, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
AT5G02860 118 / 4e-30 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT2G18940 111 / 7e-28 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G74850 110 / 1e-27 PDE343, PTAC2 PIGMENT DEFECTIVE 343, plastid transcriptionally active 2 (.1)
AT1G12775 97 / 6e-23 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G59040 95 / 5e-22 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
AT2G31400 94 / 1e-21 GUN1 genomes uncoupled 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027552 457 / 4e-162 AT3G06430 501 / 1e-175 pentatricopeptide repeat 2, embryo defective 2750, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10000862 380 / 2e-131 AT3G06430 644 / 0.0 pentatricopeptide repeat 2, embryo defective 2750, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10028683 372 / 3e-128 AT3G06430 640 / 0.0 pentatricopeptide repeat 2, embryo defective 2750, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10022787 225 / 1e-70 AT5G48730 687 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10011849 222 / 2e-69 AT5G48730 681 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10024893 192 / 2e-58 AT3G53170 543 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10035850 114 / 7e-29 AT4G39620 579 / 0.0 EMBRYO DEFECTIVE 2453, A. THALIANA PENTATRICOPEPTIDE REPEAT 5, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10022401 99 / 3e-23 AT5G01110 281 / 3e-84 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10015530 98 / 6e-23 AT2G18940 1010 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G153900 359 / 2e-123 AT3G06430 717 / 0.0 pentatricopeptide repeat 2, embryo defective 2750, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.008G098700 355 / 1e-121 AT3G06430 692 / 0.0 pentatricopeptide repeat 2, embryo defective 2750, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.002G243600 244 / 3e-78 AT5G48730 691 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.009G058300 212 / 4e-66 AT3G53170 618 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.005G082400 125 / 3e-33 AT4G39620 625 / 0.0 EMBRYO DEFECTIVE 2453, A. THALIANA PENTATRICOPEPTIDE REPEAT 5, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.002G193900 104 / 2e-25 AT2G31400 1192 / 0.0 genomes uncoupled 1 (.1)
Potri.001G297300 104 / 3e-25 AT5G02860 1129 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.006G166200 103 / 6e-25 AT2G18940 1082 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.014G118500 102 / 1e-24 AT2G31400 1213 / 0.0 genomes uncoupled 1 (.1)
Potri.015G069100 101 / 2e-24 AT1G74850 1268 / 0.0 PIGMENT DEFECTIVE 343, plastid transcriptionally active 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10039311 pacid=23175511 polypeptide=Lus10039311 locus=Lus10039311.g ID=Lus10039311.BGIv1.0 annot-version=v1.0
ATGCTGAAGCAGCAACCATTCTACAAGCCAAAAGAAGGCACCTACATGAAGCTCCTCATCCTGTTGGGGAAATCCGGCCAACCCGACCTTGCACACCAGC
TGTTGGACAAAATGCTTCAACAGGGGATTCCACCCTCCCCTGAACCCTACACTTCCCTCCTCGCGGCCTATTCCCGCAGCGGCCTAATCGACAAGGCGTT
CTCCATTCTCGAGTTAATGAAGTCCTTGCCGCAATGCCAGCCTGATGTCTTCACTTACAGCACAATTCTCAAAGCATGCGTCGACTCCTCTAGATTCGAT
CTAATCGATTCGGTCTACCTGGAAATGAAACACCGCCTCATCCTCCCCAATACCGTCACCCGAAACATTGTACTCAGTGGATACGATAGGGCTGGTTTGT
ACGACGAGATGGAAATGCTGATCAGTCGCACTGCCAAACCAGATTTATGGACTATGGATATCATCATTTCCATCTTCGGCAACAAAGGAGAAATTGAAAT
CATGGAGAAATGGTGCAAGAAGTTTCGAGACTATGGGATCGAGCCGGATATTCGGACGTTCAACATCCTGATTGGATCGTATGGGAAGGTGAGGAGCTAC
GAGAAGATGTCGTCGGTGATGGAGTATATGGGAATCCGGTGGAGTAGCTCCACTTACAACAATGTGATGGAGGCGTTTGCGGATGGAGGGGATGTGAAGA
ACATGGAGTATACCTTCAACAAGATGGGGTGA
AA sequence
>Lus10039311 pacid=23175511 polypeptide=Lus10039311 locus=Lus10039311.g ID=Lus10039311.BGIv1.0 annot-version=v1.0
MLKQQPFYKPKEGTYMKLLILLGKSGQPDLAHQLLDKMLQQGIPPSPEPYTSLLAAYSRSGLIDKAFSILELMKSLPQCQPDVFTYSTILKACVDSSRFD
LIDSVYLEMKHRLILPNTVTRNIVLSGYDRAGLYDEMEMLISRTAKPDLWTMDIIISIFGNKGEIEIMEKWCKKFRDYGIEPDIRTFNILIGSYGKVRSY
EKMSSVMEYMGIRWSSSTYNNVMEAFADGGDVKNMEYTFNKMG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G06430 AtPPR2, EMB2750 pentatricopeptide repeat 2, em... Lus10039311 0 1
AT3G22630 PRCGB, PBD1 20S proteasome beta subunit D1... Lus10006596 3.2 0.8409
AT5G24650 Mitochondrial import inner mem... Lus10032959 9.6 0.7775
AT5G39840 ATP-dependent RNA helicase, mi... Lus10034868 10.8 0.7682
AT2G40720 Tetratricopeptide repeat (TPR)... Lus10027366 12.1 0.8100
AT1G79120 Ubiquitin carboxyl-terminal hy... Lus10032172 17.0 0.7758
AT1G06730 pfkB-like carbohydrate kinase ... Lus10024866 18.0 0.7850
AT1G05750 PDE247, CLB19 pigment defective 247, Tetratr... Lus10013341 23.2 0.7745
AT3G49990 unknown protein Lus10015447 25.8 0.7686
AT1G09190 Tetratricopeptide repeat (TPR)... Lus10029853 25.9 0.7482
AT5G23200 unknown protein Lus10017393 26.7 0.7211

Lus10039311 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.