Lus10039323 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G64230 303 / 8e-108 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
AT4G27960 300 / 8e-107 UBC9 ubiquitin conjugating enzyme 9 (.1.2)
AT5G41700 300 / 8e-107 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
AT5G53300 300 / 2e-106 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
AT3G08690 297 / 2e-105 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2)
AT5G56150 281 / 2e-99 UBC30 ubiquitin-conjugating enzyme 30 (.1.2)
AT2G16740 277 / 1e-97 UBC29 ubiquitin-conjugating enzyme 29 (.1)
AT3G08700 251 / 2e-87 UBC12 ubiquitin-conjugating enzyme 12 (.1)
AT3G13550 166 / 4e-53 EMB144, COP10, CIN4, FUS9 FUSCA 9, EMBRYO DEFECTIVE 144, CONSTITUTIVE PHOTOMORPHOGENIC 10, CYTOKININ-INSENSITIVE 4, Ubiquitin-conjugating enzyme family protein (.1.2)
AT1G16890 152 / 3e-48 UBC36 ,UBC13B UBIQUITIN CONJUGATING ENZYME 13B, ubiquitin-conjugating enzyme 36 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027570 308 / 1e-109 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10014942 306 / 7e-109 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10038827 306 / 7e-109 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10032352 303 / 1e-107 AT5G53300 302 / 2e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Lus10033937 300 / 1e-106 AT5G53300 300 / 2e-106 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Lus10022726 300 / 1e-106 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10014187 300 / 1e-106 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10021385 297 / 2e-105 AT1G64230 302 / 1e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10027846 286 / 6e-101 AT1G64230 289 / 3e-102 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G094900 307 / 2e-109 AT1G64230 302 / 2e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.012G033000 305 / 8e-109 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Potri.015G023300 305 / 8e-109 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Potri.003G136200 305 / 2e-108 AT1G64230 304 / 4e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.006G110200 303 / 8e-108 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Potri.016G138900 301 / 5e-107 AT1G64230 304 / 3e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.019G131400 301 / 6e-107 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Potri.011G168200 293 / 4e-104 AT1G64230 295 / 1e-104 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.001G471200 292 / 2e-103 AT1G64230 292 / 2e-103 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.004G175000 289 / 3e-102 AT5G53300 292 / 2e-103 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0208 UBC PF00179 UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence
>Lus10039323 pacid=23175570 polypeptide=Lus10039323 locus=Lus10039323.g ID=Lus10039323.BGIv1.0 annot-version=v1.0
ATGGCGTCCAAGCGGATCTTGAAGGAACTCAAGGATTTGCAGAAGGATCCTCCTACCTCTTGCAGCGCTGGTCCTGTTGCGGAGGACATGTTTCATTGGC
AAGCAACAATTATGGGTCCTCCAGACAGCCCTTATTCAGGAGGCGTCTTCCTGGTCACTATTCATTTCCCACCTGATTACCCATTCAAGCCTCCAAAGGT
CGCATTCAGAACAAAAGTGTTCCACCCGAACATTAACAGCAACGGGAGCATCTGTCTTGATATCTTGAAAGAACAATGGAGCCCTGCTCTAACCATATCC
AAGGTATTGCTTTCAATCTGTTCATTGTTGACGGACCCTAACCCTGACGATCCGTTGGTCCCGGAGATAGCTCACATGTACAAGACAGACAGGAGCAAGT
ACGAGACAACTGCAAGAAGCTGGACCCAGAAGTACGCCATGGGCTAA
AA sequence
>Lus10039323 pacid=23175570 polypeptide=Lus10039323 locus=Lus10039323.g ID=Lus10039323.BGIv1.0 annot-version=v1.0
MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPPDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTIS
KVLLSICSLLTDPNPDDPLVPEIAHMYKTDRSKYETTARSWTQKYAMG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G64230 UBC28 ubiquitin-conjugating enzyme 2... Lus10039323 0 1
AT5G35460 unknown protein Lus10017161 1.0 0.8757
AT5G36290 Uncharacterized protein family... Lus10026995 2.4 0.8259
AT4G04770 ABCI8, ATNAP1, ... LONG AFTER FR, ARABIDOPSIS THA... Lus10035874 3.5 0.8379
AT3G09830 Protein kinase superfamily pro... Lus10013812 4.5 0.8292
AT4G26470 Calcium-binding EF-hand family... Lus10008357 5.5 0.8328
AT5G19430 RING/U-box superfamily protein... Lus10036034 6.9 0.8195
AT4G37000 ATRCCR, ACD2 ARABIDOPSIS THALIANA RED CHLOR... Lus10019349 9.5 0.8168
AT2G26660 ATSPX2 ARABIDOPSIS THALIANA SPX DOMAI... Lus10002018 11.4 0.8045
AT5G20910 AIP2 ABI3-interacting protein 2, RI... Lus10017865 11.4 0.8155
AT4G13270 Late embryogenesis abundant (L... Lus10043216 11.6 0.8035

Lus10039323 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.