Lus10039337 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G47710 43 / 5e-05 Serine protease inhibitor (SERPIN) family protein (.1)
AT1G64020 39 / 0.0003 Serine protease inhibitor (SERPIN) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009906 126 / 5e-38 AT1G47710 48 / 3e-07 Serine protease inhibitor (SERPIN) family protein (.1)
Lus10039336 128 / 3e-36 AT2G26390 105 / 2e-25 Serine protease inhibitor (SERPIN) family protein (.1)
Lus10019009 115 / 4e-31 AT1G47710 209 / 9e-64 Serine protease inhibitor (SERPIN) family protein (.1)
Lus10032600 112 / 1e-30 AT1G47710 99 / 6e-24 Serine protease inhibitor (SERPIN) family protein (.1)
Lus10009949 101 / 2e-28 ND 43 / 2e-06
Lus10002792 50 / 2e-07 AT1G47710 495 / 6e-176 Serine protease inhibitor (SERPIN) family protein (.1)
Lus10040926 47 / 2e-06 AT1G47710 115 / 2e-30 Serine protease inhibitor (SERPIN) family protein (.1)
Lus10032754 47 / 3e-06 AT1G47710 487 / 1e-172 Serine protease inhibitor (SERPIN) family protein (.1)
Lus10005087 41 / 0.0002 AT2G26390 44 / 6e-10 Serine protease inhibitor (SERPIN) family protein (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10039337 pacid=23175653 polypeptide=Lus10039337 locus=Lus10039337.g ID=Lus10039337.BGIv1.0 annot-version=v1.0
ATGGACTTCTCAATCCGCGTGCCCATAGAGACAATTCTAGGCGAACTCGACACCATAAAGAGACGCAACGCCGACGATGGTGTTCCCGCTGTGAAAAACA
CCGTCATGTCTCTGGCATCACGCGACATCTTGCTCTGTATGGTGGCTTGCAAAGCCCAAGGGCCAACCCTAGACCAGTTGCTAAGTTTCCTTGGAGAACA
AGACATCGAAGATCTCAATTTCAAAGCTTCAGTGATCATGGAAGGCTTGCGTCAAGCTCTACCACTAGAAAACGACAGAGAAAGAGCCTTCTTAGCTCGA
CAGGAAAGCGAGCCGCCAGTTATAAACCGTGCCAACGTTGGTTGGGTGGATAAGAAGTACTCATTGAGTGAATCATTAAAGAAGATGTCTATCAGGCCGA
CACCAACACTGCCGATTTTGAATTCCAGGTCCCTAAGAAAGCAGCCAAGAAAATCAATGCATGGTCAAAATAATCAACCAAAGGATGCATCGATAACATC
GTTAACTCTCGAGACATAA
AA sequence
>Lus10039337 pacid=23175653 polypeptide=Lus10039337 locus=Lus10039337.g ID=Lus10039337.BGIv1.0 annot-version=v1.0
MDFSIRVPIETILGELDTIKRRNADDGVPAVKNTVMSLASRDILLCMVACKAQGPTLDQLLSFLGEQDIEDLNFKASVIMEGLRQALPLENDRERAFLAR
QESEPPVINRANVGWVDKKYSLSESLKKMSIRPTPTLPILNSRSLRKQPRKSMHGQNNQPKDASITSLTLET

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10039337 0 1
AT3G57270 BG1 "beta-1,3-glucanase 1", beta-1... Lus10000843 4.5 1.0000
AT3G04720 HEL, PR-4, PR4 HEVEIN-LIKE, pathogenesis-rela... Lus10001774 6.5 1.0000
Lus10003843 8.9 1.0000
Lus10022996 9.2 1.0000
Lus10001326 9.3 1.0000
Lus10004351 10.5 1.0000
AT4G25640 FFT, ATDTX35 FLOWER FLAVONOID TRANSPORTER, ... Lus10038850 13.2 1.0000
AT4G22756 ATSMO1-2, ATSMO... sterol C4-methyl oxidase 1-2 (... Lus10028908 13.4 1.0000
AT5G35750 AHK2 histidine kinase 2 (.1) Lus10009736 14.1 1.0000
AT2G36870 XTH32 xyloglucan endotransglucosylas... Lus10013823 14.1 1.0000

Lus10039337 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.