Lus10039345 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G16110 122 / 4e-33 GARP ARR2 response regulator 2 (.1)
AT3G16857 122 / 5e-33 GARP ARR1 response regulator 1 (.1.2)
AT2G25180 105 / 7e-27 GARP ARR12 response regulator 12 (.1)
AT4G31920 98 / 2e-24 GARP ARR10 response regulator 10 (.1)
AT1G67710 98 / 2e-24 GARP ARR11 response regulator 11 (.1)
AT2G01760 96 / 6e-24 GARP ARR14 response regulator 14 (.1)
AT5G58080 74 / 5e-16 GARP ARR18 response regulator 18 (.1)
AT1G49190 64 / 2e-12 GARP ARR19 response regulator 19 (.1.2)
AT5G49240 56 / 1e-09 GARP APRR4 pseudo-response regulator 4 (.1)
AT2G46790 49 / 3e-07 TL1, APRR9 TOC1-LIKE PROTEIN 1, Arabidopsis pseudo-response regulator 9, pseudo-response regulator 9 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016846 144 / 8e-41 AT3G16857 603 / 0.0 response regulator 1 (.1.2)
Lus10037719 142 / 4e-40 AT3G16857 613 / 0.0 response regulator 1 (.1.2)
Lus10005340 105 / 4e-27 AT2G25180 414 / 3e-137 response regulator 12 (.1)
Lus10041020 105 / 4e-27 AT2G25180 412 / 3e-136 response regulator 12 (.1)
Lus10011389 99 / 5e-25 AT1G67710 385 / 1e-130 response regulator 11 (.1)
Lus10006446 99 / 7e-25 AT1G67710 377 / 9e-127 response regulator 11 (.1)
Lus10025044 96 / 7e-24 AT4G31920 220 / 6e-65 response regulator 10 (.1)
Lus10019058 86 / 3e-20 AT2G25180 290 / 1e-90 response regulator 12 (.1)
Lus10036303 83 / 6e-19 AT2G25180 294 / 4e-92 response regulator 12 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G001000 133 / 7e-37 AT4G16110 602 / 0.0 response regulator 2 (.1)
Potri.008G213500 128 / 6e-35 AT4G16110 602 / 0.0 response regulator 2 (.1)
Potri.008G135500 109 / 2e-28 AT4G16110 370 / 3e-119 response regulator 2 (.1)
Potri.010G105600 103 / 2e-26 AT4G16110 376 / 2e-121 response regulator 2 (.1)
Potri.008G181000 100 / 5e-25 AT1G67710 383 / 5e-127 response regulator 11 (.1)
Potri.010G053100 100 / 5e-25 AT1G67710 380 / 2e-126 response regulator 11 (.1)
Potri.018G111300 96 / 1e-23 AT2G25180 348 / 3e-111 response regulator 12 (.1)
Potri.006G188000 95 / 3e-23 AT2G25180 386 / 8e-126 response regulator 12 (.1)
Potri.006G262100 86 / 4e-20 AT2G25180 381 / 6e-124 response regulator 12 (.1)
Potri.018G021300 79 / 1e-17 AT2G25180 364 / 2e-117 response regulator 12 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0304 CheY PF00072 Response_reg Response regulator receiver domain
Representative CDS sequence
>Lus10039345 pacid=23175567 polypeptide=Lus10039345 locus=Lus10039345.g ID=Lus10039345.BGIv1.0 annot-version=v1.0
ATGAATCCCCTTAATGGATTGGAAAGGGATCCGCTTCCAGGATCACCTGAAAATCCGGCGGACCAGTGGCAGATCAGTTCCCCGCCGGGGCTGCGTGTTA
TGGTCGTTGATGAGGATCTCACTTGCGTCGTGATTCTGGAGAAGATGCTCAGAACCTGTCTTTATCGAGTGAAGAAATGCAGAAGAGCGGAGGAGGCCTT
ATCAATGTTGAGAGAGAACAGAAGTGGGGACGATATAGTGATAAGTGATGTACATATGCCAGACATATGGATGGGTTTGTGCTGCTGGAGATTGTTGGTC
TTGAAATGGATCTGCCTGTTATCTAGTGCGGTAATGAAGGGAATCACTTATGGTGCTTGTGACGATCTGATAAAGCCAGTTCGGATTGAAGTTTTGAAGA
ATACTAGATTCGATGGTCGCACGATGTTACAAATATTTTATTCGAATGTTATGTGA
AA sequence
>Lus10039345 pacid=23175567 polypeptide=Lus10039345 locus=Lus10039345.g ID=Lus10039345.BGIv1.0 annot-version=v1.0
MNPLNGLERDPLPGSPENPADQWQISSPPGLRVMVVDEDLTCVVILEKMLRTCLYRVKKCRRAEEALSMLRENRSGDDIVISDVHMPDIWMGLCCWRLLV
LKWICLLSSAVMKGITYGACDDLIKPVRIEVLKNTRFDGRTMLQIFYSNVM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G16857 GARP ARR1 response regulator 1 (.1.2) Lus10039345 0 1
Lus10006296 1.7 1.0000
Lus10012669 2.8 1.0000
Lus10013504 3.5 1.0000
Lus10033834 3.7 1.0000
Lus10026042 4.0 1.0000
AT2G18560 UDP-Glycosyltransferase superf... Lus10008248 4.0 1.0000
Lus10032814 4.9 1.0000
AT3G44460 bZIP DPBF2, ATBZIP67 basic leucine zipper transcrip... Lus10019542 5.1 1.0000
Lus10016136 5.5 1.0000
AT4G35500 Protein kinase superfamily pro... Lus10016690 7.4 1.0000

Lus10039345 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.