Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G32030 116 / 6e-34 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) AT2G32020 102 / 2e-28 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) AT3G22560 82 / 1e-20 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039344 [exp] 142 / 4e-44 AT2G32030 236 / 4e-80 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Lus10010570 [exp] 134 / 8e-41 AT2G32030 220 / 7e-74 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Lus10021914 [exp] 94 / 3e-25 AT3G22560 216 / 2e-72 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Lus10006668 [exp] 82 / 4e-20 AT2G32030 122 / 2e-35 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Lus10041199 [exp] 74 / 5e-18 AT3G22560 128 / 7e-39 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Lus10039343 [exp] 69 / 4e-15 AT3G22560 151 / 1e-46 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Lus10010569 [exp] 66 / 2e-14 AT3G22560 144 / 7e-44 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Lus10007013 [exp] 67 / 7e-14 AT5G64300 506 / 4e-174 RED FLUORESCENT IN DARKNESS 1, Arabidopsis thaliana riboflavin A1, ARABIDOPSIS THALIANA GTP CYCLOHYDROLASE II, GTP cyclohydrolase II (.1) Lus10032323 [exp] 57 / 1e-10 AT2G32030 107 / 6e-29 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G085600 [exp] 130 / 2e-39 AT2G32030 223 / 6e-75 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Potri.008G154700 [exp] 107 / 2e-30 AT3G22560 177 / 3e-57 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Potri.008G154800 [exp] 104 / 3e-29 AT3G22560 225 / 3e-76 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Potri.007G102900 [exp] 65 / 4e-14 AT3G22560 96 / 9e-26 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0257 [flax] [poplar] Acetyltrans PF00583 [flax] [poplar] Acetyltransf_1 Acetyltransferase (GNAT) family
Representative CDS sequence Show only first row Show all	>Lus10039346 pacid=23175476 polypeptide=Lus10039346 locus=Lus10039346.g ID=Lus10039346.BGIv1.0 annot-version=v1.0 ATGCACCAGCAAAGAAGAAGGCCTCAATTTCATAAGGAGCACTGGTCTTCCCCACCCGTGGTCTGCATTGACGGCAGGCCCATCGGCGACATTTCCGTGA GGAAAAATTCAGAGGGAGACGCTTGCCGAGGGGAGATAGGCTACATGCTGGCATCTGGATATCGGGGGAGAGGGATTACGACGGCGGCGGAAACGAGATT CAAGGAGCAGCCGGAGTTGGAAAGGTTAGAAGCGCGGGTGGATGTGGAGAACGTTGCGTCACAAAGGTTTTTGGAGAAGGTTGGATTTGTGAGGGAAGGT GTGCCGAGGAAATTCATGCTTTTGAAGGGGAGGTCTCGAGATATGGTTATGTTAAACCTTTTGTCTACTGAACTTGTGAGTTAG
AA sequence Show only first row Show all	>Lus10039346 pacid=23175476 polypeptide=Lus10039346 locus=Lus10039346.g ID=Lus10039346.BGIv1.0 annot-version=v1.0 MHQQRRRPQFHKEHWSSPPVVCIDGRPIGDISVRKNSEGDACRGEIGYMLASGYRGRGITTAAETRFKEQPELERLEARVDVENVASQRFLEKVGFVREG VPRKFMLLKGRSRDMVMLNLLSTELVS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G32030			Acyl-CoA N-acyltransferases (N...		Lus10039346 [exp]	0	1
AT2G04520			Nucleic acid-binding, OB-fold-...		Lus10042438 [exp]	3.3	0.6747
AT5G20630		ATGER3, GLP3A, ...	GERMIN-LIKE PROTEIN 3, ARABIDO...		Lus10015645 [exp]	9.2	0.6074
AT1G22400		ATUGT85A1, UGT8...	ARABIDOPSIS THALIANA UDP-GLUCO...		Lus10013920 [exp]	12.7	0.5706
AT2G16730		BGAL13	beta-galactosidase 13, glycosy...		Lus10014126 [exp]	14.7	0.5706
AT5G45670			GDSL-like Lipase/Acylhydrolase...		Lus10015241 [exp]	16.4	0.5706
AT1G08580			unknown protein		Lus10000388 [exp]	16.5	0.5683
AT5G20260			Exostosin family protein (.1)		Lus10039980 [exp]	18.0	0.5706
AT1G22380		ATUGT85A3	UDP-glucosyl transferase 85A3 ...		Lus10013919 [exp]	21.7	0.5505
AT1G18010			Major facilitator superfamily ...		Lus10009413 [exp]	22.4	0.5475
AT3G14250			RING/U-box superfamily protein...		Lus10022064 [exp]	23.9	0.5367

Compare expression of checked genes

Lus10039346 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.