Lus10039350 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010576 0 / 1 AT4G14805 87 / 5e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10039350 pacid=23175551 polypeptide=Lus10039350 locus=Lus10039350.g ID=Lus10039350.BGIv1.0 annot-version=v1.0
ATGGCTAACTTCCACTCCCTGGAGACTCTCTGTGCAGGTTTTCCTCCTCCTCCAAGCTCATCGAACTCAGTAGGAGCGCCGACGTCATCTGACTCTGGTT
CAGATGATTATACGTCTCCTGAGAATGATCCGCCAACTGAACCTACTGAAGTTCCAACCGTATCTGGTGCTCATAATACGACACTTGCTCCCCCGGAACC
ACCTGCTGAAGCTGGTAAACCTGCCCCTGATGCATCATCTACACCAAGTCCCTCAGATGCAAATGCTCAAGTCTCATCGCCAACTAGCTTCATCAATGGC
AGCAGAATTGAGCTCAATCCCGACTTGGTTTTTCCACGGAGCTGCTGCCCTTTAATTGCTTTTGTAACTTGTTTGATGCTACACAGATGA
AA sequence
>Lus10039350 pacid=23175551 polypeptide=Lus10039350 locus=Lus10039350.g ID=Lus10039350.BGIv1.0 annot-version=v1.0
MANFHSLETLCAGFPPPPSSSNSVGAPTSSDSGSDDYTSPENDPPTEPTEVPTVSGAHNTTLAPPEPPAEAGKPAPDASSTPSPSDANAQVSSPTSFING
SRIELNPDLVFPRSCCPLIAFVTCLMLHR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10039350 0 1
AT1G70570 anthranilate phosphoribosyltra... Lus10006201 2.4 0.9287
AT3G11340 UGT76B1 UDP-dependent glycosyltransfer... Lus10037268 4.6 0.9375
AT3G06240 F-box family protein (.1) Lus10001105 6.8 0.9337
AT1G32170 XTH30, XTR4 xyloglucan endotransglycosylas... Lus10010427 9.7 0.9233
AT1G74790 catalytics (.1) Lus10033116 10.0 0.9255
AT1G68400 leucine-rich repeat transmembr... Lus10040653 11.0 0.9158
AT4G13830 J20 DNAJ-like 20 (.1.2) Lus10003149 16.4 0.9170
AT5G51500 Plant invertase/pectin methyle... Lus10031140 16.9 0.8977
AT1G17020 ATSRG1, SRG1 senescence-related gene 1 (.1) Lus10015252 18.0 0.8996
AT2G39710 Eukaryotic aspartyl protease f... Lus10004713 19.4 0.9033

Lus10039350 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.