Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G22630 371 / 5e-133 PRCGB, PBD1 20S proteasome beta subunit D1 (.1) AT4G14800 362 / 2e-129 PBD2 20S proteasome beta subunit D2 (.1.2) AT3G14290 65 / 8e-13 PAE2 20S proteasome alpha subunit E2 (.1) AT1G53850 64 / 2e-12 PAE1, ATPAE1 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2) AT4G31300 59 / 1e-10 PBA1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) AT3G26340 56 / 3e-09 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) AT1G13060 56 / 3e-09 PBE1 20S proteasome beta subunit E1 (.1.2) AT5G40580 49 / 6e-07 PBB2 20S proteasome beta subunit PBB2 (.1.2.3) AT3G27430 48 / 1e-06 PBB1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) AT3G60820 47 / 2e-06 PBF1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041194 [exp] 392 / 2e-141 AT3G22630 363 / 9e-130 20S proteasome beta subunit D1 (.1) Lus10021909 [exp] 387 / 2e-139 AT3G22630 360 / 2e-128 20S proteasome beta subunit D1 (.1) Lus10006596 [exp] 204 / 3e-68 AT3G22630 168 / 2e-54 20S proteasome beta subunit D1 (.1) Lus10020180 [exp] 64 / 2e-12 AT4G31300 429 / 7e-155 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10026984 [exp] 65 / 3e-12 AT4G31300 357 / 2e-124 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Lus10003936 [exp] 64 / 9e-12 AT1G53850 463 / 9e-162 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2) Lus10037454 [exp] 63 / 1e-11 AT1G53850 464 / 8e-163 ARABIDOPSIS 20S PROTEASOME ALPHA SUBUNIT E1, 20S proteasome alpha subunit E1 (.1.2) Lus10011369 [exp] 54 / 2e-08 AT3G26340 465 / 1e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Lus10006426 [exp] 52 / 5e-08 AT3G26340 462 / 7e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G084800 [exp] 378 / 9e-136 AT3G22630 366 / 6e-131 20S proteasome beta subunit D1 (.1) Potri.008G155500 [exp] 376 / 6e-135 AT3G22630 364 / 6e-130 20S proteasome beta subunit D1 (.1) Potri.006G077900 [exp] 64 / 1e-12 AT4G31300 416 / 2e-149 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.001G162900 [exp] 64 / 3e-12 AT3G14290 471 / 4e-171 20S proteasome alpha subunit E2 (.1) Potri.018G145900 [exp] 62 / 1e-11 AT4G31300 405 / 3e-145 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.003G072500 [exp] 61 / 4e-11 AT3G14290 464 / 1e-168 20S proteasome alpha subunit E2 (.1) Potri.008G177000 [exp] 54 / 1e-08 AT3G26340 473 / 7e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Potri.010G058100 [exp] 53 / 2e-08 AT3G26340 463 / 6e-167 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1) Potri.014G069800 [exp] 51 / 7e-08 AT3G60820 362 / 6e-129 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3) Potri.002G148300 [exp] 49 / 5e-07 AT3G60820 387 / 2e-138 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0052 [flax] [poplar] NTN PF00227 [flax] [poplar] Proteasome Proteasome subunit
Representative CDS sequence Show only first row Show all	>Lus10039351 pacid=23175612 polypeptide=Lus10039351 locus=Lus10039351.g ID=Lus10039351.BGIv1.0 annot-version=v1.0 ATGGAGTGCGTGTTCGGTTTAGTTGGAAGCGACTTCGCCATCGTGGCGGCTGATTCGTCCGCCGTGCACAGCATCTTGGTTCACAAATCCAATGAGGACA AGATCATGGTCCTTGACTCACACAAGCTCGTAGCCGCCAGCGGCGAGCCCGGTGACAGGGTTCAATTCACGGAGTATATCCAGAAGAACGTGTCTCTGTA CCAATTCAGGAATGGAATTCCTCTCACCACGGCGGCTGCAGCCAACTTCACTCGTGGAGAGCTGGCTACTGCCTTGAGGAAGAACCCATATCAAGTTAAC ATCTTGATGGCTGGCTATGACAAGGAGACTGGACCGTCTTTGTATTACATCGACTACATCGCTACCCTTCATAAAGTCGACAGGGGAGCTTTTGGGTATG GTTCCTACTTCTGCCTTTCCATGATGGATAGACTCTATCACAGTGGCATGACCGTGGATGAAGCAATTGATCTGGTAGATAAATGCATCCTGGAGATCCG GTCGAGATTGGTAGTAGCACCGCCGAACTTCGTCATTAAGATCGTTGACAAGGATGGAGCAAGGGAGTATGCCTGGCGTGAATCAGTGAAGGATGGTGCA TCAGCTTAA
AA sequence Show only first row Show all	>Lus10039351 pacid=23175612 polypeptide=Lus10039351 locus=Lus10039351.g ID=Lus10039351.BGIv1.0 annot-version=v1.0 MECVFGLVGSDFAIVAADSSAVHSILVHKSNEDKIMVLDSHKLVAASGEPGDRVQFTEYIQKNVSLYQFRNGIPLTTAAAANFTRGELATALRKNPYQVN ILMAGYDKETGPSLYYIDYIATLHKVDRGAFGYGSYFCLSMMDRLYHSGMTVDEAIDLVDKCILEIRSRLVVAPPNFVIKIVDKDGAREYAWRESVKDGA SA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G22630		PRCGB, PBD1	20S proteasome beta subunit D1...		Lus10039351 [exp]	0	1
AT4G25050		ACP4	acyl carrier protein 4 (.1.2)		Lus10038636 [exp]	2.4	0.7972
AT1G26910		RPL10B	ribosomal protein L10 B, Ribos...		Lus10031002 [exp]	4.1	0.8297
AT1G26910		RPL10B	ribosomal protein L10 B, Ribos...		Lus10035401 [exp]	6.6	0.8118
AT5G13710		CPH, SMT1	CEPHALOPOD, sterol methyltrans...		Lus10029498 [exp]	10.4	0.7410
AT2G30410		TFCA, KIS	TUBULIN FOLDING FACTOR A, tubu...		Lus10031896 [exp]	13.6	0.7901
AT2G34480			Ribosomal protein L18ae/LX fam...		Lus10019881 [exp]	14.3	0.7902
AT5G58490			NAD(P)-binding Rossmann-fold s...		Lus10026385 [exp]	14.5	0.7335
AT3G45030			Ribosomal protein S10p/S20e fa...		Lus10031126 [exp]	16.1	0.7399
AT5G13710		CPH, SMT1	CEPHALOPOD, sterol methyltrans...		Lus10039600 [exp]	17.0	0.7517
AT3G45030			Ribosomal protein S10p/S20e fa...		Lus10031706 [exp]	18.3	0.7820

Compare expression of checked genes

Lus10039351 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.