Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G50850 120 / 5e-34 MAB1 MACCI-BOU, Transketolase family protein (.1) AT1G30120 46 / 8e-07 PDH-E1 BETA, PDH-E1BETA pyruvate dehydrogenase E1 beta (.1) AT2G34590 45 / 1e-06 Transketolase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032550 [exp] 137 / 9e-41 AT5G50850 613 / 0.0 MACCI-BOU, Transketolase family protein (.1) Lus10043191 [exp] 137 / 5e-39 AT5G50850 635 / 0.0 MACCI-BOU, Transketolase family protein (.1) Lus10032549 [exp] 134 / 2e-38 AT5G50850 628 / 0.0 MACCI-BOU, Transketolase family protein (.1) Lus10038505 [exp] 45 / 1e-06 AT2G34590 693 / 0.0 Transketolase family protein (.1) Lus10023304 [exp] 45 / 1e-06 AT2G34590 687 / 0.0 Transketolase family protein (.1) Lus10013401 [exp] 42 / 3e-05 AT1G55510 622 / 0.0 branched-chain alpha-keto acid decarboxylase E1 beta subunit (.1) Lus10010324 [exp] 42 / 3e-05 AT1G55510 619 / 0.0 branched-chain alpha-keto acid decarboxylase E1 beta subunit (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G061400 [exp] 138 / 8e-41 AT5G50850 640 / 0.0 MACCI-BOU, Transketolase family protein (.1) Potri.003G166400 [exp] 136 / 4e-40 AT5G50850 636 / 0.0 MACCI-BOU, Transketolase family protein (.1) Potri.017G076500 [exp] 46 / 6e-07 AT2G34590 671 / 0.0 Transketolase family protein (.1) Potri.004G129800 [exp] 44 / 5e-06 AT2G34590 634 / 0.0 Transketolase family protein (.1) Potri.003G222800 [exp] 41 / 3e-05 AT1G55510 632 / 0.0 branched-chain alpha-keto acid decarboxylase E1 beta subunit (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0591 [flax] [poplar] TKC_like PF02780 [flax] [poplar] Transketolase_C Transketolase, C-terminal domain
Representative CDS sequence Show only first row Show all	>Lus10039361 pacid=23175486 polypeptide=Lus10039361 locus=Lus10039361.g ID=Lus10039361.BGIv1.0 annot-version=v1.0 ATGGCGAGTCTTTTTCTGTTTTTAGCAGAAGTTCTTGATTCAAGTTTCTGTCTTTCTATAAGCAAAGCCAAGATTGAAGGGGAAGGCAAGGATGTAACAA TTACTGCTTTTTTGAATATGGTTAGCTATGCACTAAAGGCTGTTGAAATTTTGGCTAAAGAAGGGATAAATGTTAATGTTATAAATATAGGATCTATCCG TCCCCTTGATAGAGCCACAATCAACAACCCTGTGAGGAAAGCAAATCGATTGGTTACTCTTGAAGAAGGATTTTCGCAACATGGAGTTGGTGCTGAGATG TGTCTCAGTTGTTGA
AA sequence Show only first row Show all	>Lus10039361 pacid=23175486 polypeptide=Lus10039361 locus=Lus10039361.g ID=Lus10039361.BGIv1.0 annot-version=v1.0 MASLFLFLAEVLDSSFCLSISKAKIEGEGKDVTITAFLNMVSYALKAVEILAKEGINVNVINIGSIRPLDRATINNPVRKANRLVTLEEGFSQHGVGAEM CLSC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G50850		MAB1	MACCI-BOU, Transketolase famil...		Lus10039361 [exp]	0	1
					Lus10005514 [exp]	4.0	1.0000
AT1G28300	B3	LEC2	LEAFY COTYLEDON 2, AP2/B3-like...		Lus10014005 [exp]	5.5	1.0000
AT3G02960			Heavy metal transport/detoxifi...		Lus10015762 [exp]	6.7	1.0000
AT5G05070			DHHC-type zinc finger family p...		Lus10027274 [exp]	7.7	1.0000
AT5G27260			unknown protein		Lus10007175 [exp]	8.9	1.0000
AT3G60730			Plant invertase/pectin methyle...		Lus10015877 [exp]	9.5	1.0000
AT1G66350	GRAS	RGL1	RGA-like 1 (.1)		Lus10016888 [exp]	10.2	1.0000
AT2G36190		ATCWINV4	cell wall invertase 4 (.1)		Lus10017015 [exp]	11.3	1.0000
AT1G61320			FBD / Leucine Rich Repeat doma...		Lus10010664 [exp]	11.6	1.0000
AT5G12060			Plant self-incompatibility pro...		Lus10030964 [exp]	13.4	1.0000

Compare expression of checked genes

Lus10039361 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.