Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010271 [exp] 108 / 3e-32 ND / Lus10017734 [exp] 106 / 2e-31 ND / Lus10013669 [exp] 99 / 2e-28 ND / Lus10006589 [exp] 103 / 6e-28 AT3G18970 140 / 2e-37 mitochondrial editing factor 20 (.1) Lus10014486 [exp] 74 / 5e-17 ND / Lus10012424 [exp] 66 / 6e-16 ND / Lus10031094 [exp] 42 / 9e-06 ND 39 / 0.003 Lus10014482 [exp] 40 / 2e-05 ND 38 / 3e-04 Lus10040059 [exp] 38 / 0.0004 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039365 pacid=23175513 polypeptide=Lus10039365 locus=Lus10039365.g ID=Lus10039365.BGIv1.0 annot-version=v1.0 ATGACAGATGTGATGGATGGAGGTCCCAGCTTGGGTGGTGCAAGTGGAGCTGGTGGTGGGGGTGATGATGAACGCCGTCCCAAAAAGGAACAAAGGCAAT GGTGGGATATACAACTAGTTGATGCGAATGATGAAGATTTGGGGATTGAGCCTTGGAAGACAAAAGATTGGGCAAAGTTAGGGTGTAACAGGAAGAAGAT AATGGTAGACGTTGACTCATTTGGGCTTCCATCCGGGGAGAGTGGTGGATATTTGTGCTAG
AA sequence Show only first row Show all	>Lus10039365 pacid=23175513 polypeptide=Lus10039365 locus=Lus10039365.g ID=Lus10039365.BGIv1.0 annot-version=v1.0 MTDVMDGGPSLGGASGAGGGGDDERRPKKEQRQWWDIQLVDANDEDLGIEPWKTKDWAKLGCNRKKIMVDVDSFGLPSGESGGYLC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10039365 [exp]	0	1
					Lus10019211 [exp]	2.4	0.7907
AT4G17380		MSH4, ATMSH4	ARABIDOPSIS MUTS HOMOLOG 4, M...		Lus10028966 [exp]	6.8	0.8090
AT5G57280		RID2	root initiation defective 2, S...		Lus10015533 [exp]	8.8	0.7939
AT4G04750			Major facilitator superfamily ...		Lus10018957 [exp]	12.2	0.7349
AT4G10120		ATSPS4F	Sucrose-phosphate synthase fam...		Lus10006183 [exp]	20.1	0.6983
AT5G01750			Protein of unknown function (D...		Lus10009094 [exp]	34.5	0.7085
AT5G10420			MATE efflux family protein (.1...		Lus10015904 [exp]	34.7	0.7222
AT2G28480			RNA-binding CRS1 / YhbY (CRM) ...		Lus10041459 [exp]	49.4	0.6501
AT2G14910			unknown protein		Lus10026601 [exp]	58.5	0.6525
AT2G22260			oxidoreductase, 2OG-Fe(II) oxy...		Lus10039112 [exp]	63.9	0.6516

Compare expression of checked genes

Lus10039365 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.