Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G14750 38 / 0.0006 IQD19 IQ-domain 19 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006613 [exp] 106 / 4e-28 AT4G14750 295 / 6e-96 IQ-domain 19 (.1) Lus10041188 [exp] 72 / 6e-16 AT4G14750 288 / 2e-93 IQ-domain 19 (.1) Lus10021904 [exp] 69 / 2e-14 AT4G14750 314 / 2e-103 IQ-domain 19 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G156700 [exp] 63 / 2e-12 AT4G14750 307 / 6e-101 IQ-domain 19 (.1) Potri.010G082600 [exp] 55 / 6e-10 AT4G14750 261 / 2e-83 IQ-domain 19 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039367 pacid=23175638 polypeptide=Lus10039367 locus=Lus10039367.g ID=Lus10039367.BGIv1.0 annot-version=v1.0 ATGGGGAAGACCGGCAAATGGCTTAAGGGTTTCTTGTCTGGGAAGAAAGAGAAGGACAAGGAGAAGGAGAGGCGGAGAGATAGCAGAGATCATAAGGAGA TCATATGTATTGATTCCCAGGATTCCAATCCATCATCTACTCCAATTTCTCACCCACCAACCACTCCTAAAGAGAAGCGGAGATGGAGTTTCAGAAGGTC ATCAGCTACTGGAATGGCCAATTCTGCAGAACCATCTTCCCCAGGTGCCGCTGCAAAGCCGTCGGAGATGCAGGCGGAATTGGATTCTGAAAATGAGCAG AACAAACACGCGATAAATGCCCGTGACAGGCGAGGAAGGCATTGCGAGCGCTGA
AA sequence Show only first row Show all	>Lus10039367 pacid=23175638 polypeptide=Lus10039367 locus=Lus10039367.g ID=Lus10039367.BGIv1.0 annot-version=v1.0 MGKTGKWLKGFLSGKKEKDKEKERRRDSRDHKEIICIDSQDSNPSSTPISHPPTTPKEKRRWSFRRSSATGMANSAEPSSPGAAAKPSEMQAELDSENEQ NKHAINARDRRGRHCER

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G14750		IQD19	IQ-domain 19 (.1)		Lus10039367 [exp]	0	1
AT4G14750		IQD19	IQ-domain 19 (.1)		Lus10039366 [exp]	1.0	0.9474
AT1G76890	Trihelix	AT-GT2, GT2	Duplicated homeodomain-like su...		Lus10009184 [exp]	3.2	0.8757
AT4G24140		BDG3	alpha/beta-Hydrolases superfam...		Lus10033234 [exp]	6.7	0.8109
AT2G41640			Glycosyltransferase family 61 ...		Lus10042044 [exp]	8.3	0.8339
AT5G27740		RFC3, EMB251, E...	replication factor C 3, EMBRYO...		Lus10019391 [exp]	12.2	0.7884
AT5G28300	Trihelix		Duplicated homeodomain-like su...		Lus10015924 [exp]	13.3	0.7739
AT2G45970		CYP86A8, LCR	LACERATA, "cytochrome P450, fa...		Lus10017789 [exp]	13.4	0.8312
AT1G05230	HD	HDG2	homeodomain GLABROUS 2 (.1.2.3...		Lus10027175 [exp]	14.4	0.7947
AT5G16000		NIK1	NSP-interacting kinase 1 (.1)		Lus10005103 [exp]	16.7	0.7086
AT5G63810		BGAL10	beta-galactosidase 10 (.1)		Lus10022645 [exp]	17.5	0.8036

Compare expression of checked genes

Lus10039367 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.