Lus10039369 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G50150 63 / 1e-12 Plant protein of unknown function (DUF247) (.1)
AT3G44700 61 / 8e-12 Plant protein of unknown function (.1)
AT3G50160 61 / 8e-12 Plant protein of unknown function (DUF247) (.1)
AT2G36430 60 / 1e-11 Plant protein of unknown function (DUF247) (.1)
AT3G50120 59 / 4e-11 Plant protein of unknown function (DUF247) (.1)
AT4G31980 59 / 6e-11 unknown protein
AT3G50180 58 / 8e-11 Plant protein of unknown function (DUF247) (.1)
AT3G50130 57 / 1e-10 Plant protein of unknown function (DUF247) (.1)
AT3G50170 57 / 2e-10 Plant protein of unknown function (DUF247) (.1), Plant protein of unknown function (DUF247) (.2)
AT5G22540 57 / 2e-10 Plant protein of unknown function (DUF247) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009871 115 / 2e-31 AT3G50120 246 / 4e-76 Plant protein of unknown function (DUF247) (.1)
Lus10011501 71 / 3e-15 AT3G50120 716 / 0.0 Plant protein of unknown function (DUF247) (.1)
Lus10038338 61 / 7e-12 AT4G31980 251 / 5e-76 unknown protein
Lus10027719 61 / 1e-11 AT2G36430 424 / 5e-146 Plant protein of unknown function (DUF247) (.1)
Lus10035569 60 / 3e-11 AT2G36430 427 / 2e-147 Plant protein of unknown function (DUF247) (.1)
Lus10017132 59 / 6e-11 AT3G50120 157 / 6e-42 Plant protein of unknown function (DUF247) (.1)
Lus10020563 55 / 8e-10 AT3G47250 204 / 2e-62 Plant protein of unknown function (DUF247) (.1), Plant protein of unknown function (DUF247) (.2), Plant protein of unknown function (DUF247) (.3)
Lus10038339 54 / 2e-09 AT3G50160 230 / 8e-70 Plant protein of unknown function (DUF247) (.1)
Lus10010065 54 / 3e-09 AT3G50150 240 / 2e-73 Plant protein of unknown function (DUF247) (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G017600 74 / 1e-16 AT4G31980 229 / 3e-68 unknown protein
Potri.003G181800 74 / 2e-16 AT2G36430 238 / 1e-73 Plant protein of unknown function (DUF247) (.1)
Potri.003G206801 73 / 4e-16 AT4G31980 261 / 3e-80 unknown protein
Potri.004G187100 73 / 4e-16 AT5G22540 418 / 7e-144 Plant protein of unknown function (DUF247) (.1)
Potri.001G017900 73 / 6e-16 AT4G31980 274 / 4e-85 unknown protein
Potri.003G181600 72 / 2e-15 AT2G36430 241 / 5e-75 Plant protein of unknown function (DUF247) (.1)
Potri.007G047700 71 / 4e-15 AT3G50120 721 / 0.0 Plant protein of unknown function (DUF247) (.1)
Potri.T012600 70 / 5e-15 AT4G31980 254 / 1e-77 unknown protein
Potri.005G116100 69 / 8e-15 AT2G36430 511 / 4e-180 Plant protein of unknown function (DUF247) (.1)
Potri.007G013800 67 / 4e-14 AT2G36430 508 / 3e-179 Plant protein of unknown function (DUF247) (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03140 DUF247 Plant protein of unknown function
Representative CDS sequence
>Lus10039369 pacid=23175520 polypeptide=Lus10039369 locus=Lus10039369.g ID=Lus10039369.BGIv1.0 annot-version=v1.0
ATGGGAAGAACTGAAACTGTCGACGATTTATCAACGCGAATCGTTGAAAAGCTTTGCGGGTCATCTCCTACTACCTCCAGGTTCAGCATCTTCAAGGTGC
CTCAACAGCTACGCAAGGTTAACGAGAAGGCAAACGAGCCACAGGTACTCGCAATTGGGCCTTACCATCATGGTAGTGCACACTTGCAGAAGATGGAGGA
GCACAAACTACAGTATCTTAGCCAACTTCTGCGCAGGAGAAGCGAAGAGGAATATAGCCGTGTGAGCCTGTATGTCTCGGCGATAAGGAAGCTAGAAGAA
ACAACTCGGAAATGCTATGCAGATTCCTTCCCTGTAACATCATCAGATGACTTTGTCGAAATGATGCTTCCTCGTTGA
AA sequence
>Lus10039369 pacid=23175520 polypeptide=Lus10039369 locus=Lus10039369.g ID=Lus10039369.BGIv1.0 annot-version=v1.0
MGRTETVDDLSTRIVEKLCGSSPTTSRFSIFKVPQQLRKVNEKANEPQVLAIGPYHHGSAHLQKMEEHKLQYLSQLLRRRSEEEYSRVSLYVSAIRKLEE
TTRKCYADSFPVTSSDDFVEMMLPR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G50150 Plant protein of unknown funct... Lus10039369 0 1
AT1G15740 Leucine-rich repeat family pro... Lus10038107 3.5 0.9499
AT1G18470 Transmembrane Fragile-X-F-asso... Lus10042969 3.7 0.9517
AT1G04970 lipid-binding serum glycoprote... Lus10014625 4.5 0.9526
AT1G69550 disease resistance protein (TI... Lus10001038 4.9 0.9423
AT1G15740 Leucine-rich repeat family pro... Lus10008036 7.7 0.9497
AT3G20250 APUM5 pumilio 5 (.1) Lus10033353 11.2 0.9418
AT1G05410 Protein of unknown function (D... Lus10041201 13.7 0.9378
AT4G27745 Yippee family putative zinc-bi... Lus10007773 16.9 0.9381
AT4G32440 Plant Tudor-like RNA-binding p... Lus10024835 17.2 0.9473
AT1G11530 ATCXXS1 C-terminal cysteine residue is... Lus10018383 18.0 0.9448

Lus10039369 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.