Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G04240 251 / 1e-85 AUX_IAA IAA3, SHY2 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) AT5G43700 245 / 2e-83 AUX_IAA IAA4, ATAUX2-11 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) AT3G23030 209 / 1e-69 AUX_IAA IAA2 indole-3-acetic acid inducible 2 (.1) AT4G14560 202 / 9e-67 AUX_IAA AXR5, IAA1 AUXIN RESISTANT 5, indole-3-acetic acid inducible (.1) AT4G14550 176 / 1e-55 AUX_IAA SLR, IAA14 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) AT3G04730 174 / 5e-55 AUX_IAA IAA16 indoleacetic acid-induced protein 16 (.1) AT4G29080 173 / 1e-53 AUX_IAA IAA27, PAP2 indole-3-acetic acid inducible 27, phytochrome-associated protein 2 (.1) AT3G23050 170 / 3e-53 AUX_IAA AXR2, IAA7 AUXIN RESISTANT 2, indole-3-acetic acid 7 (.1.2) AT3G15540 160 / 8e-50 AUX_IAA MSG2, IAA19 MASSUGU 2, indole-3-acetic acid inducible 19 (.1) AT1G04250 161 / 9e-50 AUX_IAA IAA17, AXR3 indole-3-acetic acid inducible 17, AUXIN RESISTANT 3, AUX/IAA transcriptional regulator family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039488 [exp] 379 / 3e-136 AT5G43700 247 / 3e-84 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Lus10014729 [exp] 236 / 1e-79 AT1G04240 230 / 2e-77 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) Lus10002723 [exp] 224 / 7e-75 AT5G43700 221 / 4e-74 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Lus10024853 [exp] 219 / 7e-73 AT1G04240 216 / 1e-71 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) Lus10018764 [exp] 218 / 2e-72 AT5G43700 210 / 4e-69 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Lus10028222 [exp] 196 / 7e-63 AT5G65670 322 / 3e-110 indole-3-acetic acid inducible 9 (.1.2) Lus10042929 [exp] 179 / 3e-55 AT5G65670 356 / 3e-122 indole-3-acetic acid inducible 9 (.1.2) Lus10019241 [exp] 177 / 4e-55 AT5G65670 356 / 4e-123 indole-3-acetic acid inducible 9 (.1.2) Lus10011583 [exp] 176 / 1e-54 AT5G65670 333 / 2e-114 indole-3-acetic acid inducible 9 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G078400 [exp] 275 / 2e-95 AT5G43700 248 / 9e-85 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.008G161100 [exp] 271 / 5e-93 AT5G43700 238 / 3e-80 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.005G218200 [exp] 261 / 2e-89 AT5G43700 243 / 2e-82 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.013G041300 [exp] 257 / 6e-88 AT5G43700 239 / 5e-81 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.002G045000 [exp] 254 / 1e-86 AT5G43700 236 / 5e-80 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.005G053800 [exp] 252 / 5e-86 AT5G43700 239 / 7e-81 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.008G161200 [exp] 179 / 2e-56 AT4G14550 343 / 1e-120 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Potri.013G041400 [exp] 176 / 1e-55 AT3G04730 306 / 6e-106 indoleacetic acid-induced protein 16 (.1) Potri.002G044900 [exp] 174 / 1e-54 AT4G14550 286 / 1e-98 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Potri.005G053900 [exp] 167 / 6e-52 AT3G04730 317 / 3e-110 indoleacetic acid-induced protein 16 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF02309 [flax] [poplar] AUX_IAA AUX/IAA family
Representative CDS sequence Show only first row Show all	>Lus10039413 pacid=23175616 polypeptide=Lus10039413 locus=Lus10039413.g ID=Lus10039413.BGIv1.0 annot-version=v1.0 ATGGAAGGTGTTGCATATGAAAATGACTTGAACTTCAAGGCAACCGAGCTCAGGCTTGGACTGCCTGGCTCAGGACAAGAAGAAGAAGAAACTGCTGTTA AAAGCAACAACCACAACAAGCGACCTATGCCTGCAGAGACCAATGAAGAAACCGAAGCCAAGGGAAGATCTGGAGATCATGTTCAAGCTGCCCCTGCTGC TAAGGCACAGATTGTGGGCTGGCCACCAATCCGATCCTACAGGAAGAATAGCTTGCAGCCAAAGAAAAGTACTGAAGCTGCTGATGGTGCTAGCGGGATG TACGTGAAAGTTAGCATGGATGGAGCACCATATCTCAGGAAGATTGACCTCAAGGTCTATAGAGGCTACCCTGAACTCCTAATGGCTTTGGAGACCATGT TTAAGTTTGCTGCGGGTGTCTATTCTGAGAGAGAAGGCTATAAAGGGTCCGAGCACGTACCTACTTATGAAGACAAAGATGGTGACTGGATGCTCGTTGG AGATGTTCCTTGGGACATGTTCATGTCATCCTGTAAGAGGTTGAGAATCATGAAAGGATCAGAAGCAAGAGGATTGGGATGTGGTGTATGA
AA sequence Show only first row Show all	>Lus10039413 pacid=23175616 polypeptide=Lus10039413 locus=Lus10039413.g ID=Lus10039413.BGIv1.0 annot-version=v1.0 MEGVAYENDLNFKATELRLGLPGSGQEEEETAVKSNNHNKRPMPAETNEETEAKGRSGDHVQAAPAAKAQIVGWPPIRSYRKNSLQPKKSTEAADGASGM YVKVSMDGAPYLRKIDLKVYRGYPELLMALETMFKFAAGVYSEREGYKGSEHVPTYEDKDGDWMLVGDVPWDMFMSSCKRLRIMKGSEARGLGCGV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G04240	AUX_IAA	IAA3, SHY2	SHORT HYPOCOTYL 2, indole-3-ac...		Lus10039413 [exp]	0	1
AT5G10750			Protein of unknown function (D...		Lus10026907 [exp]	1.0	0.8490
AT5G43700	AUX_IAA	IAA4, ATAUX2-11	indole-3-acetic acid inducible...		Lus10039488 [exp]	2.6	0.7821
AT5G03960		IQD12	IQ-domain 12 (.1)		Lus10042027 [exp]	3.5	0.7850
AT3G47640	bHLH	PYE, bHLH047, P...	POPEYE, basic helix-loop-helix...		Lus10008622 [exp]	8.3	0.7906
AT1G05870			Protein of unknown function (D...		Lus10025562 [exp]	10.2	0.7885
AT5G06440			unknown protein		Lus10021251 [exp]	11.4	0.7771
					Lus10004148 [exp]	12.7	0.8077
AT3G11590			unknown protein		Lus10005200 [exp]	14.7	0.7203
AT5G35180			Protein of unknown function (D...		Lus10040011 [exp]	18.7	0.7704
AT5G40870		UKL1, ATUK/UPRT...	URIDINE KINASE-LIKE 1, uridine...		Lus10032051 [exp]	19.4	0.7339

Compare expression of checked genes

Lus10039413 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.