Lus10039418 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019378 42 / 5e-05 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10039418 pacid=23175573 polypeptide=Lus10039418 locus=Lus10039418.g ID=Lus10039418.BGIv1.0 annot-version=v1.0
ATGGCCACCCTGCTAGTGGATCGAGGGTCATGGATGATGTCCCCTCTCGTCACGCAATGGCGTCACTTTGATTCTGATACCTTGCAACCTGTTAAAAGTG
GGGCTCCTTCTATTCTGCCACCTCTGCCGCCACTGTCATCTCTTGGCTGTTGCTTCGGTGGTCGAGCTCTGACGACTTCCAGATCTTGGGGTTCGAGCAA
GATAACGACGGCTTGGTTCCCTCTTTTAAAATTTGCGCTACTGGAAACCCTTTTGGGCCCGCTATTCACCCACCACTCTCTCTTGATGCAGGCTCCTTGC
AGAACTGGGCCACACTCCCATGCCGATGTTACCTCCAAAGACTGTGTGCCTCACCTTCACACTGGGTCGCATGCCCAAGCAGACGCCACCTCCAAGGCAC
GGCATAACGACTCAGCTGGCACTTGGCTCTTTCATTCTTCTAAGGGTGGGTCAAAGTCTCCTTCGCCTACTGTTGGGCCTATCACGTCGGTCCCTCCCTT
GCCACCCTTATAG
AA sequence
>Lus10039418 pacid=23175573 polypeptide=Lus10039418 locus=Lus10039418.g ID=Lus10039418.BGIv1.0 annot-version=v1.0
MATLLVDRGSWMMSPLVTQWRHFDSDTLQPVKSGAPSILPPLPPLSSLGCCFGGRALTTSRSWGSSKITTAWFPLLKFALLETLLGPLFTHHSLLMQAPC
RTGPHSHADVTSKDCVPHLHTGSHAQADATSKARHNDSAGTWLFHSSKGGSKSPSPTVGPITSVPPLPPL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10039418 0 1
Lus10000377 1.7 0.8535
AT2G27550 ATC centroradialis (.1) Lus10015520 5.7 0.7610
AT4G25570 ACYB-2 Cytochrome b561/ferric reducta... Lus10028996 5.8 0.8449
AT5G05970 NEDD1 NEURAL PRECURSOR CELL EXPRESSE... Lus10040260 11.1 0.8122
AT5G09970 CYP78A7 "cytochrome P450, family 78, s... Lus10006821 17.5 0.7688
AT4G37370 CYP81D8 "cytochrome P450, family 81, s... Lus10024816 17.7 0.7504
AT1G14185 Glucose-methanol-choline (GMC)... Lus10024728 19.5 0.7327
Lus10023005 20.9 0.7278
AT3G18590 AtENODL5 early nodulin-like protein 5 (... Lus10014880 22.5 0.7294
AT4G09890 Protein of unknown function (D... Lus10033529 25.5 0.7867

Lus10039418 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.