Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G08570 215 / 5e-73 Heavy metal transport/detoxification superfamily protein (.1) AT4G39700 180 / 5e-59 Heavy metal transport/detoxification superfamily protein (.1) AT1G22990 161 / 1e-51 HIPP22 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) AT4G38580 147 / 8e-46 HIPP26, ATFP6 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) AT1G71050 143 / 2e-44 HIPP20 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) AT5G66110 143 / 2e-44 HIPP27 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1) AT4G35060 127 / 5e-38 HIPP25 heavy metal associated isoprenylated plant protein 25, Heavy metal transport/detoxification superfamily protein (.1) AT5G17450 126 / 6e-38 HIPP21 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) AT1G06330 97 / 3e-26 Heavy metal transport/detoxification superfamily protein (.1) AT4G10465 85 / 3e-21 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019676 [exp] 190 / 1e-62 AT4G39700 211 / 3e-71 Heavy metal transport/detoxification superfamily protein (.1) Lus10016436 [exp] 188 / 4e-62 AT4G39700 209 / 1e-70 Heavy metal transport/detoxification superfamily protein (.1) Lus10022508 [exp] 172 / 8e-56 AT4G39700 201 / 2e-67 Heavy metal transport/detoxification superfamily protein (.1) Lus10042946 [exp] 161 / 1e-51 AT1G71050 196 / 3e-65 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10016708 [exp] 158 / 2e-50 AT1G71050 192 / 1e-63 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10036004 [exp] 158 / 3e-50 AT1G22990 187 / 4e-62 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Lus10016812 [exp] 154 / 2e-48 AT4G39700 181 / 3e-59 Heavy metal transport/detoxification superfamily protein (.1) Lus10014120 [exp] 149 / 1e-46 AT4G38580 253 / 5e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Lus10019789 [exp] 148 / 3e-46 AT4G38580 254 / 4e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G167000 [exp] 246 / 3e-85 AT4G08570 229 / 1e-78 Heavy metal transport/detoxification superfamily protein (.1) Potri.002G092200 [exp] 244 / 2e-84 AT4G08570 193 / 3e-64 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G003700 [exp] 217 / 9e-74 AT4G08570 207 / 5e-70 Heavy metal transport/detoxification superfamily protein (.1) Potri.007G087300 [exp] 204 / 2e-68 AT4G39700 215 / 9e-73 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G079800 [exp] 194 / 2e-64 AT4G39700 189 / 2e-62 Heavy metal transport/detoxification superfamily protein (.1) Potri.010G114600 [exp] 159 / 1e-50 AT1G22990 194 / 9e-65 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Potri.004G175400 [exp] 149 / 7e-47 AT4G38580 254 / 2e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.009G135300 [exp] 147 / 5e-46 AT4G38580 234 / 3e-80 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.017G123400 [exp] 145 / 4e-45 AT5G17450 220 / 4e-75 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Potri.005G110400 [exp] 134 / 5e-41 AT5G66110 189 / 2e-62 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [flax] [poplar] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Lus10039419 pacid=23175667 polypeptide=Lus10039419 locus=Lus10039419.g ID=Lus10039419.BGIv1.0 annot-version=v1.0 ATGGGAGTTTCCGGGACAGTTGAGTACCTCTCAGAGCTACTGAGCAGCATGAAATCAAACAAGAGGAAGAAGAAGCAAATGCAAACTGTTGCCCTAAAAA TCAGAATGGACTGTGAAGGCTGTCAGCGCAAAGTCAAGAGCGTGCTCTCCGCTGTTAAAGGAGCTAAGAAAGTGGAAGTGGACATGAAGCAACAGAAGGC AACAGTGAGTGGGTACGTAGATCCAAAGAAGGTGTTGAAGGCAGCTGAAGCAACTAAGAAGAAAGTTGAACTGTGGCCCTATGTTCCATACACTTTAGTG GCAAACCCATACGTGTCACAGGCTTACGACAAGAAAGCTCCTCCCAACCATGTTAGAGCAGTGCCATCGACGGCCACCTTCAATGACCAGACTACCTTCG ATGACACTTACACAACCATGTTCAGTGAGGATAATCCAAACGCTTGTTTCATTATGTAA
AA sequence Show only first row Show all	>Lus10039419 pacid=23175667 polypeptide=Lus10039419 locus=Lus10039419.g ID=Lus10039419.BGIv1.0 annot-version=v1.0 MGVSGTVEYLSELLSSMKSNKRKKKQMQTVALKIRMDCEGCQRKVKSVLSAVKGAKKVEVDMKQQKATVSGYVDPKKVLKAAEATKKKVELWPYVPYTLV ANPYVSQAYDKKAPPNHVRAVPSTATFNDQTTFDDTYTTMFSEDNPNACFIM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G08570			Heavy metal transport/detoxifi...		Lus10039419 [exp]	0	1
AT5G49650		XK2, XK-2	XYLULOSE KINASE 2, xylulose ki...		Lus10007234 [exp]	1.4	0.9530
AT5G47040		LON2	lon protease 2 (.1)		Lus10040131 [exp]	4.0	0.9197
AT5G21170		AKINBETA1	5'-AMP-activated protein kinas...		Lus10041287 [exp]	4.2	0.8989
AT5G47040		LON2	lon protease 2 (.1)		Lus10001084 [exp]	6.2	0.9145
AT5G49650		XK2, XK-2	XYLULOSE KINASE 2, xylulose ki...		Lus10028235 [exp]	7.1	0.9012
AT1G15060			Uncharacterised conserved prot...		Lus10013496 [exp]	8.0	0.8869
					Lus10007992 [exp]	10.2	0.8825
AT3G17770			Dihydroxyacetone kinase (.1)		Lus10031879 [exp]	10.4	0.8774
AT3G62950			Thioredoxin superfamily protei...		Lus10040898 [exp]	10.8	0.8200
AT1G73750			Uncharacterised conserved prot...		Lus10007966 [exp]	11.3	0.9103

Compare expression of checked genes

Lus10039419 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.