Lus10039426 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G28050 91 / 2e-22 nodulin MtN21 /EamA-like transporter family protein (.1)
AT5G40230 86 / 2e-20 nodulin MtN21 /EamA-like transporter family protein (.1)
AT5G40240 81 / 1e-18 nodulin MtN21 /EamA-like transporter family protein (.1.2)
AT3G28100 74 / 2e-16 nodulin MtN21 /EamA-like transporter family protein (.1)
AT4G15540 72 / 1e-15 EamA-like transporter family (.1)
AT5G40210 72 / 2e-15 nodulin MtN21 /EamA-like transporter family protein (.1)
AT3G28070 71 / 2e-15 nodulin MtN21 /EamA-like transporter family protein (.1.2.3)
AT3G28130 71 / 3e-15 nodulin MtN21 /EamA-like transporter family protein (.1.2)
AT3G28080 69 / 2e-14 nodulin MtN21 /EamA-like transporter family protein (.1.2.3)
AT1G44800 54 / 4e-09 nodulin MtN21 /EamA-like transporter family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039428 161 / 2e-49 AT3G28050 343 / 2e-117 nodulin MtN21 /EamA-like transporter family protein (.1)
Lus10039429 152 / 4e-45 AT3G28050 354 / 6e-120 nodulin MtN21 /EamA-like transporter family protein (.1)
Lus10039425 132 / 8e-38 AT3G28050 453 / 4e-160 nodulin MtN21 /EamA-like transporter family protein (.1)
Lus10039479 130 / 3e-37 AT3G28050 457 / 1e-161 nodulin MtN21 /EamA-like transporter family protein (.1)
Lus10039430 108 / 5e-29 AT3G28050 315 / 8e-107 nodulin MtN21 /EamA-like transporter family protein (.1)
Lus10039478 102 / 1e-26 AT3G28050 385 / 2e-133 nodulin MtN21 /EamA-like transporter family protein (.1)
Lus10039433 72 / 2e-15 AT3G28050 175 / 3e-52 nodulin MtN21 /EamA-like transporter family protein (.1)
Lus10039481 70 / 7e-15 AT5G40240 265 / 2e-86 nodulin MtN21 /EamA-like transporter family protein (.1.2)
Lus10030842 69 / 2e-14 AT3G28050 244 / 1e-78 nodulin MtN21 /EamA-like transporter family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G337100 119 / 4e-33 AT3G28050 367 / 4e-126 nodulin MtN21 /EamA-like transporter family protein (.1)
Potri.003G192900 74 / 3e-16 AT3G28050 222 / 1e-69 nodulin MtN21 /EamA-like transporter family protein (.1)
Potri.008G145800 72 / 2e-15 AT3G28050 283 / 2e-93 nodulin MtN21 /EamA-like transporter family protein (.1)
Potri.015G073200 70 / 9e-15 AT5G40240 254 / 4e-82 nodulin MtN21 /EamA-like transporter family protein (.1.2)
Potri.001G032100 66 / 3e-13 AT3G28050 224 / 3e-70 nodulin MtN21 /EamA-like transporter family protein (.1)
Potri.002G040200 59 / 7e-11 AT1G44800 261 / 1e-84 nodulin MtN21 /EamA-like transporter family protein (.1)
Potri.015G042900 57 / 3e-10 AT3G18200 476 / 4e-169 nodulin MtN21 /EamA-like transporter family protein (.1.2)
Potri.005G176100 56 / 1e-09 AT4G08290 427 / 2e-149 nodulin MtN21 /EamA-like transporter family protein (.1.2)
Potri.005G233600 52 / 1e-08 AT1G75500 584 / 0.0 Walls Are Thin 1 (.1.2)
Potri.010G096100 51 / 3e-08 AT1G70260 415 / 4e-145 nodulin MtN21 /EamA-like transporter family protein (.1)
PFAM info
Representative CDS sequence
>Lus10039426 pacid=23175481 polypeptide=Lus10039426 locus=Lus10039426.g ID=Lus10039426.BGIv1.0 annot-version=v1.0
ATGGAGGGCATGAACCCCCACGTCTTTGTTGCCTACGTCCATGGAATTGCCGCACGGATGGAAAAAGTTGTGGTGAGGAGAAGATCCAGTCAAGCCAAGG
TAATGGGGGCGATTGTGTCAATAGCAGGTGCTATCGGTGTAACCCTTTACAAGGGCCCTGCGTTAAAGACAACTCCCACTAGCCAAAGCCAAAGCCAAAA
CCAAAACTGGGTCCTCGGTGGGGTTTTCCTCACCTTTGAGTACATTCTGATTCCTTTATGGTTCATCGGCCAGACGCAAATAATGAAGGAGTACCCAGCT
GAACTCGCAGTAGTCTTCCTTTACCTTCTAGTTGCGAGCATCGTTGCAGCATCTGTGGCTTTGATTATAGAAGGAATTTCTCCTACTGCCTGGTGCTCAA
GACACAGCCAGCTGGTTTCCTCAAGCTTTTGCTAA
AA sequence
>Lus10039426 pacid=23175481 polypeptide=Lus10039426 locus=Lus10039426.g ID=Lus10039426.BGIv1.0 annot-version=v1.0
MEGMNPHVFVAYVHGIAARMEKVVVRRRSSQAKVMGAIVSIAGAIGVTLYKGPALKTTPTSQSQSQNQNWVLGGVFLTFEYILIPLWFIGQTQIMKEYPA
ELAVVFLYLLVASIVAASVALIIEGISPTAWCSRHSQLVSSSFC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G28050 nodulin MtN21 /EamA-like trans... Lus10039426 0 1
AT1G24764 ATMAP70-2 microtubule-associated protein... Lus10019171 2.6 0.8002
AT2G20410 RNA-binding ASCH domain protei... Lus10000855 3.5 0.7369
AT1G29400 AML5 MEI2-like protein 5 (.1.2) Lus10007346 6.3 0.7754
Lus10025748 7.2 0.7904
Lus10005485 8.5 0.6183
AT4G01410 Late embryogenesis abundant (L... Lus10012605 11.0 0.7761
AT5G57685 LSB1, ATGDU3 LESS SUSCEPTIBLE TO BSCTV 1, A... Lus10019986 12.0 0.7472
AT1G61140 EDA16 embryo sac development arrest ... Lus10018465 13.0 0.7072
AT1G14750 SDS SOLO DANCERS, Cyclin family pr... Lus10034581 18.0 0.6708
AT5G57685 LSB1, ATGDU3 LESS SUSCEPTIBLE TO BSCTV 1, A... Lus10019985 20.1 0.7021

Lus10039426 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.