Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012425 [exp] 98 / 1e-26 ND / Lus10002726 [exp] 78 / 5e-19 ND 37 / 0.008 Lus10002163 [exp] 72 / 2e-17 ND / Lus10029533 [exp] 71 / 9e-16 AT2G01170 133 / 2e-34 bidirectional amino acid transporter 1 (.1.2) Lus10031094 [exp] 56 / 8e-11 ND 39 / 0.003 Lus10040059 [exp] 55 / 1e-10 ND / Lus10016234 [exp] 52 / 2e-10 ND / Lus10040039 [exp] 53 / 3e-10 ND / Lus10039612 [exp] 52 / 9e-10 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03004 [flax] [poplar] Transposase_24 Plant transposase (Ptta/En/Spm family)
Representative CDS sequence Show only first row Show all	>Lus10039432 pacid=23175627 polypeptide=Lus10039432 locus=Lus10039432.g ID=Lus10039432.BGIv1.0 annot-version=v1.0 ATGAAGTTAGCCATGTATGGGACATGTGCATATAAACGTTCTGTCAGTAACAAAGAGAACAGAGCTGCTCAAGATGTTTATCATACTTCTGGTTCAAAGC TGTTCAACAGAAAGAAGAAAGAAATGACGGAAGTTAAGGCCTTCATGGATGATCCATACACTGCTCTAGGATTTAATCTAAATGATGCAGTTGGTCGAAG TTATCCTAGTGGAGAAGTAATTAACAGCTTGATGACTTTCCGCTGTTAA
AA sequence Show only first row Show all	>Lus10039432 pacid=23175627 polypeptide=Lus10039432 locus=Lus10039432.g ID=Lus10039432.BGIv1.0 annot-version=v1.0 MKLAMYGTCAYKRSVSNKENRAAQDVYHTSGSKLFNRKKKEMTEVKAFMDDPYTALGFNLNDAVGRSYPSGEVINSLMTFRC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10039432 [exp]	0	1
AT1G02335		GL22	germin-like protein subfamily ...		Lus10004856 [exp]	1.7	1.0000
					Lus10002332 [exp]	4.5	1.0000
AT2G43870			Pectin lyase-like superfamily ...		Lus10011417 [exp]	5.5	1.0000
AT3G05950			RmlC-like cupins superfamily p...		Lus10023351 [exp]	6.3	1.0000
					Lus10030331 [exp]	6.9	0.9864
AT3G53710		AGD6	ARF-GAP domain 6 (.1.2)		Lus10012991 [exp]	7.1	1.0000
AT3G19270		CYP707A4	"cytochrome P450, family 707, ...		Lus10014056 [exp]	7.7	1.0000
					Lus10017627 [exp]	7.7	0.9171
AT1G17930			Aminotransferase-like, plant m...		Lus10031075 [exp]	8.4	1.0000
AT5G06060			NAD(P)-binding Rossmann-fold s...		Lus10010873 [exp]	8.8	0.9701

Compare expression of checked genes

Lus10039432 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.