Lus10039434 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10039434 pacid=23175509 polypeptide=Lus10039434 locus=Lus10039434.g ID=Lus10039434.BGIv1.0 annot-version=v1.0
ATGGACGTCTCTTCTGCTCCTTCCCCTTCAAACAGTCATGTCCAATCCCTAGAAAACCAAGCTTCCAAGACCTCAACAGAGTTTCAATCCGAGAGTATCA
AACAGCAAACCAACAAATCTGATGCTGTGTTGGGTAAAAGTGGGACGTCCTTACTATCTTTAGAAGGATCTACACCAAGTTTCAAGAAGCAGATTCCTAA
ATCTAAGGGGAAGAACGTCTCCAAAATTGCAAGTATGGTTGACACTACCGGAATTGTTCATTCGAAGACTTCTATCAAGCGACGCAAGAAGGTTGTTGTT
ACCCCTTCGTGCGATTTCACCTCTCCAGTGGAAGCTTCACAGTGGCACCAACAGCTGAGAGATGCCCCAATCCTGGAGTTTGATGATGATGATGATTTTG
ACTCTGATGATGTTTGA
AA sequence
>Lus10039434 pacid=23175509 polypeptide=Lus10039434 locus=Lus10039434.g ID=Lus10039434.BGIv1.0 annot-version=v1.0
MDVSSAPSPSNSHVQSLENQASKTSTEFQSESIKQQTNKSDAVLGKSGTSLLSLEGSTPSFKKQIPKSKGKNVSKIASMVDTTGIVHSKTSIKRRKKVVV
TPSCDFTSPVEASQWHQQLRDAPILEFDDDDDFDSDDV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10039434 0 1
AT4G28450 nucleotide binding;protein bin... Lus10015673 11.2 0.6906
AT1G27680 APL2 ADPGLC-PPase large subunit (.1... Lus10010088 11.9 0.7283
AT5G12200 PYD2 pyrimidine 2 (.1) Lus10036064 13.9 0.7179
AT2G34930 disease resistance family prot... Lus10002753 16.6 0.6284
AT3G27670 RST1 RESURRECTION1, ARM repeat supe... Lus10013075 23.2 0.6898
AT1G55310 ATSCL33, SR33, ... SC35-like splicing factor 33 (... Lus10017299 24.1 0.6986
AT4G21510 F-box family protein (.1) Lus10022370 28.8 0.7119
AT5G49720 TSD1, IRX2, DEC... TUMOROUS SHOOT DEVELOPMENT 1, ... Lus10026275 38.7 0.6562
AT2G45910 U-box domain-containing protei... Lus10036363 42.4 0.6964
AT5G41650 Lactoylglutathione lyase / gly... Lus10024719 47.1 0.6270

Lus10039434 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.