Lus10039435 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10039435 pacid=23175662 polypeptide=Lus10039435 locus=Lus10039435.g ID=Lus10039435.BGIv1.0 annot-version=v1.0
ATGAGTGATATTGAACAAGTCATGTTCTTCAAACGCACTGCTAAATTTTGGACGTTGTGTCGTCGCCATCAATCACTCCTCTACTGTGTCCCTCGCTCTA
ACCAACCACATCCTCAACTCCAATCGACCGACGGACTCGATGAGGTCACAGCATCAAGGAGCAGCGCTGATGAGGTTGGAGGCATGGATGGAGGAGTCGG
TGATTTGACTAAAGGTGGAGATGTTGATGTTGTCGTTCTGAAAAGCCGGAGATGA
AA sequence
>Lus10039435 pacid=23175662 polypeptide=Lus10039435 locus=Lus10039435.g ID=Lus10039435.BGIv1.0 annot-version=v1.0
MSDIEQVMFFKRTAKFWTLCRRHQSLLYCVPRSNQPHPQLQSTDGLDEVTASRSSADEVGGMDGGVGDLTKGGDVDVVVLKSRR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10039435 0 1
AT4G17810 C2H2ZnF ZFP12 C2H2 and C2HC zinc fingers sup... Lus10004578 1.0 0.9202
AT1G20590 Cyclin family protein (.1) Lus10036416 4.0 0.7370
AT1G10385 Vps51/Vps67 family (components... Lus10017692 6.0 0.8521
AT5G61890 AP2_ERF Integrase-type DNA-binding sup... Lus10022426 8.7 0.7614
AT5G47670 CCAAT NF-YB6, L1L "nuclear factor Y, subunit B6"... Lus10008978 11.0 0.7512
AT3G55700 UDP-Glycosyltransferase superf... Lus10040724 12.2 0.7512
Lus10003695 13.4 0.7512
Lus10020958 14.5 0.7512
AT1G55790 Domain of unknown function (DU... Lus10032899 14.5 0.7126
Lus10021906 15.5 0.7512

Lus10039435 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.